Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) stbDE/ParE-YafN
Location 222284..222806 Replicon plasmid pKP424-2
Accession NZ_CP109984
Organism Klebsiella pneumoniae strain KP424

Toxin (Protein)


Gene name stbE Uniprot ID A0A2J4R0S6
Locus tag OJ961_RS27595 Protein ID WP_004181778.1
Coordinates 222522..222806 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name stbD Uniprot ID A0A2J4R0U8
Locus tag OJ961_RS27590 Protein ID WP_004181777.1
Coordinates 222284..222532 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OJ961_RS27570 (OJ961_27575) 217493..218314 - 822 WP_004181772.1 hypothetical protein -
OJ961_RS27575 (OJ961_27580) 218376..218729 - 354 WP_004181774.1 hypothetical protein -
OJ961_RS27580 (OJ961_27585) 218874..219860 - 987 WP_101992392.1 hypothetical protein -
OJ961_RS27585 (OJ961_27590) 220194..221993 - 1800 WP_004181776.1 ATP-dependent helicase -
OJ961_RS27590 (OJ961_27595) 222284..222532 + 249 WP_004181777.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OJ961_RS27595 (OJ961_27600) 222522..222806 + 285 WP_004181778.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OJ961_RS27600 (OJ961_27605) 222823..222924 - 102 Protein_245 IS200/IS605 family transposase -
OJ961_RS27605 (OJ961_27610) 222960..224186 + 1227 WP_040209639.1 RNA-guided endonuclease TnpB family protein -
OJ961_RS27610 (OJ961_27615) 224457..224681 - 225 Protein_247 transposase -
OJ961_RS27615 (OJ961_27620) 224760..225188 - 429 WP_077257669.1 IS200/IS605 family transposase -
OJ961_RS27620 (OJ961_27625) 225224..226411 + 1188 WP_040209642.1 RNA-guided endonuclease TnpB family protein -
OJ961_RS27625 (OJ961_27630) 226456..226827 - 372 WP_040209644.1 hypothetical protein -
OJ961_RS27630 (OJ961_27635) 226824..227168 - 345 WP_223811496.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 iucA / iucB / iucC / iucD / iutA / rmpA 1..293179 293179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10970.69 Da        Isoelectric Point: 10.6516

>T262621 WP_004181778.1 NZ_CP109984:222522-222806 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN

Download         Length: 285 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8925.17 Da        Isoelectric Point: 3.8209

>AT262621 WP_004181777.1 NZ_CP109984:222284-222532 [Klebsiella pneumoniae]
MAFQVLTTTAASITELKRDPMGTFNAGEGAPVAILNRNEPAFYCVPPALYAQLMELLEDQELGRIADERIGEAVIEVSLD
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4R0S6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4R0U8

References