262620

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 118065..118735 Replicon plasmid pKP424-2
Accession NZ_CP109984
Organism Klebsiella pneumoniae strain KP424

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag OJ961_RS27030 Protein ID WP_004213072.1
Coordinates 118065..118508 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag OJ961_RS27035 Protein ID WP_004213073.1
Coordinates 118505..118735 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OJ961_RS26995 (OJ961_27000) 113476..113751 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
OJ961_RS27000 (OJ961_27005) 113814..114305 + 492 WP_011251327.1 DM13 domain-containing protein -
OJ961_RS27005 (OJ961_27010) 114354..115274 + 921 WP_004213934.1 DUF1471 domain-containing protein -
OJ961_RS27010 (OJ961_27015) 115365..115768 + 404 Protein_127 GAF domain-containing protein -
OJ961_RS27015 (OJ961_27020) 116286..116921 - 636 WP_165475474.1 mucoid phenotype regulator RmpA2 -
OJ961_RS27020 (OJ961_27025) 117338..117642 + 305 Protein_129 transposase -
OJ961_RS27025 (OJ961_27030) 117665..117916 - 252 WP_186987481.1 hypothetical protein -
OJ961_RS27030 (OJ961_27035) 118065..118508 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
OJ961_RS27035 (OJ961_27040) 118505..118735 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OJ961_RS27040 (OJ961_27045) 119343..120476 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
OJ961_RS27045 (OJ961_27050) 120492..120785 + 294 WP_004213076.1 hypothetical protein -
OJ961_RS27050 (OJ961_27055) 120775..120981 - 207 WP_004213077.1 hypothetical protein -
OJ961_RS27055 (OJ961_27060) 121333..121623 + 291 WP_004213078.1 hypothetical protein -
OJ961_RS27060 (OJ961_27065) 121613..122512 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 iucA / iucB / iucC / iucD / iutA / rmpA 1..293179 293179


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T262620 WP_004213072.1 NZ_CP109984:c118508-118065 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT262620 WP_004213073.1 NZ_CP109984:c118735-118505 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References