Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 41197..41723 | Replicon | plasmid pKP424-2 |
Accession | NZ_CP109984 | ||
Organism | Klebsiella pneumoniae strain KP424 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | OJ961_RS26635 | Protein ID | WP_000323025.1 |
Coordinates | 41436..41723 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | OJ961_RS26630 | Protein ID | WP_000534858.1 |
Coordinates | 41197..41436 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OJ961_RS26600 (OJ961_26605) | 37582..37893 | + | 312 | Protein_45 | IS110 family transposase | - |
OJ961_RS26605 (OJ961_26610) | 37903..38211 | - | 309 | Protein_46 | integrase core domain-containing protein | - |
OJ961_RS26610 (OJ961_26615) | 38228..39304 | - | 1077 | WP_000227969.1 | IS110 family transposase | - |
OJ961_RS26615 (OJ961_26620) | 39586..40445 | - | 860 | Protein_48 | IS3-like element ISEc52 family transposase | - |
OJ961_RS26620 (OJ961_26625) | 40518..40934 | + | 417 | Protein_49 | cation-efflux pump | - |
OJ961_RS26625 (OJ961_26630) | 41068..41172 | - | 105 | Protein_50 | hypothetical protein | - |
OJ961_RS26630 (OJ961_26635) | 41197..41436 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
OJ961_RS26635 (OJ961_26640) | 41436..41723 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
OJ961_RS26640 (OJ961_26645) | 41795..41953 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
OJ961_RS26645 (OJ961_26650) | 42556..43530 | + | 975 | WP_004181899.1 | hypothetical protein | - |
OJ961_RS26650 (OJ961_26655) | 43728..44105 | - | 378 | WP_004181901.1 | hypothetical protein | - |
OJ961_RS26655 (OJ961_26660) | 44795..45862 | + | 1068 | WP_004181903.1 | hypothetical protein | - |
OJ961_RS26660 (OJ961_26665) | 46018..46365 | + | 348 | WP_004181904.1 | hypothetical protein | - |
OJ961_RS26665 (OJ961_26670) | 46444..46677 | + | 234 | WP_004181905.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 | iucA / iucB / iucC / iucD / iutA / rmpA | 1..293179 | 293179 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T262619 WP_000323025.1 NZ_CP109984:41436-41723 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|