Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4824400..4825235 Replicon chromosome
Accession NZ_CP109983
Organism Klebsiella pneumoniae strain KP424

Toxin (Protein)


Gene name yeeV Uniprot ID A0A5E2RWI0
Locus tag OJ961_RS23395 Protein ID WP_001559913.1
Coordinates 4824400..4824777 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A5E3EVB5
Locus tag OJ961_RS23400 Protein ID WP_032408847.1
Coordinates 4824867..4825235 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OJ961_RS23355 (4819665) 4819665..4819931 + 267 WP_004178415.1 hypothetical protein -
OJ961_RS23360 (4819931) 4819931..4820603 + 673 Protein_4580 DUF4400 domain-containing protein -
OJ961_RS23365 (4820614) 4820614..4821330 + 717 WP_232152072.1 RES domain-containing protein -
OJ961_RS23370 (4821698) 4821698..4821886 - 189 Protein_4582 transposase -
OJ961_RS23375 (4821903) 4821903..4823014 - 1112 Protein_4583 IS3 family transposase -
OJ961_RS23380 (4823464) 4823464..4823613 - 150 Protein_4584 restriction endonuclease subunit M -
OJ961_RS23385 (4823698) 4823698..4823895 - 198 WP_032408848.1 DUF957 domain-containing protein -
OJ961_RS23390 (4823915) 4823915..4824403 - 489 WP_001559914.1 DUF5983 family protein -
OJ961_RS23395 (4824400) 4824400..4824777 - 378 WP_001559913.1 TA system toxin CbtA family protein Toxin
OJ961_RS23400 (4824867) 4824867..4825235 - 369 WP_032408847.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OJ961_RS23405 (4825412) 4825412..4825633 - 222 WP_000692300.1 DUF987 domain-containing protein -
OJ961_RS23410 (4825702) 4825702..4826178 - 477 WP_032408846.1 RadC family protein -
OJ961_RS23415 (4826193) 4826193..4826678 - 486 WP_088607457.1 antirestriction protein -
OJ961_RS23420 (4826770) 4826770..4827588 - 819 WP_001559911.1 DUF932 domain-containing protein -
OJ961_RS23425 (4827688) 4827688..4827921 - 234 WP_001119729.1 DUF905 family protein -
OJ961_RS23430 (4828000) 4828000..4828455 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4812777..4843191 30414


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14148.10 Da        Isoelectric Point: 7.8276

>T262614 WP_001559913.1 NZ_CP109983:c4824777-4824400 [Klebsiella pneumoniae]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13682.62 Da        Isoelectric Point: 7.8398

>AT262614 WP_032408847.1 NZ_CP109983:c4825235-4824867 [Klebsiella pneumoniae]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVMLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5E2RWI0

Antitoxin

Source ID Structure
AlphaFold DB A0A5E3EVB5

References