Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4151509..4152128 Replicon chromosome
Accession NZ_CP109983
Organism Klebsiella pneumoniae strain KP424

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OJ961_RS20195 Protein ID WP_002892050.1
Coordinates 4151910..4152128 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OJ961_RS20190 Protein ID WP_002892066.1
Coordinates 4151509..4151883 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OJ961_RS20180 (4146661) 4146661..4147854 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OJ961_RS20185 (4147877) 4147877..4151023 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OJ961_RS20190 (4151509) 4151509..4151883 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OJ961_RS20195 (4151910) 4151910..4152128 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OJ961_RS20200 (4152287) 4152287..4152853 + 567 WP_002892030.1 maltose O-acetyltransferase -
OJ961_RS20205 (4152825) 4152825..4152965 - 141 WP_004147370.1 hypothetical protein -
OJ961_RS20210 (4152986) 4152986..4153456 + 471 WP_002892026.1 YlaC family protein -
OJ961_RS20215 (4153431) 4153431..4154865 - 1435 Protein_3968 PLP-dependent aminotransferase family protein -
OJ961_RS20220 (4154966) 4154966..4155664 + 699 WP_002892021.1 GNAT family protein -
OJ961_RS20225 (4155661) 4155661..4155801 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OJ961_RS20230 (4155801) 4155801..4156064 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T262612 WP_002892050.1 NZ_CP109983:4151910-4152128 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT262612 WP_002892066.1 NZ_CP109983:4151509-4151883 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References