Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 111260..111930 Replicon plasmid pA
Accession NZ_CP109974
Organism Klebsiella pneumoniae strain 857

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag OI501_RS27500 Protein ID WP_004213072.1
Coordinates 111260..111703 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag OI501_RS27505 Protein ID WP_004213073.1
Coordinates 111700..111930 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI501_RS27465 (OI501_27470) 106671..106946 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
OI501_RS27470 (OI501_27475) 107009..107500 + 492 WP_011251327.1 DM13 domain-containing protein -
OI501_RS27475 (OI501_27480) 107549..108469 + 921 WP_004213934.1 DUF1471 domain-containing protein -
OI501_RS27480 (OI501_27485) 108560..108963 + 404 Protein_126 GAF domain-containing protein -
OI501_RS27485 (OI501_27490) 109481..110116 - 636 Protein_127 mucoid phenotype regulator RmpA2 -
OI501_RS27490 (OI501_27495) 110533..110837 + 305 Protein_128 transposase -
OI501_RS27495 (OI501_27500) 110860..111111 - 252 WP_186987481.1 hypothetical protein -
OI501_RS27500 (OI501_27505) 111260..111703 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
OI501_RS27505 (OI501_27510) 111700..111930 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OI501_RS27510 (OI501_27515) 112538..113671 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
OI501_RS27515 (OI501_27520) 113687..113980 + 294 WP_004213076.1 hypothetical protein -
OI501_RS27520 (OI501_27525) 113970..114176 - 207 WP_004213077.1 hypothetical protein -
OI501_RS27525 (OI501_27530) 114528..114818 + 291 WP_004213078.1 hypothetical protein -
OI501_RS27530 (OI501_27535) 114808..115707 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..192941 192941


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T262595 WP_004213072.1 NZ_CP109974:c111703-111260 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT262595 WP_004213073.1 NZ_CP109974:c111930-111700 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References