Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 77573..78483 Replicon plasmid pA
Accession NZ_CP109974
Organism Klebsiella pneumoniae strain 857

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag OI501_RS27300 Protein ID WP_004026354.1
Coordinates 77573..78043 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag OI501_RS27305 Protein ID WP_004026357.1
Coordinates 78040..78483 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI501_RS27260 (OI501_27265) 72889..73203 + 315 WP_011251273.1 hypothetical protein -
OI501_RS27265 (OI501_27270) 73212..73706 + 495 WP_011251274.1 hypothetical protein -
OI501_RS27270 (OI501_27275) 73712..74152 + 441 WP_011251275.1 hypothetical protein -
OI501_RS27275 (OI501_27280) 74577..75533 - 957 WP_011251280.1 DsbA family protein -
OI501_RS27280 (OI501_27285) 75593..75934 - 342 WP_011251281.1 hypothetical protein -
OI501_RS27285 (OI501_27290) 75948..76259 - 312 WP_011251282.1 hypothetical protein -
OI501_RS27290 (OI501_27295) 76276..76725 - 450 WP_011251283.1 thioredoxin fold domain-containing protein -
OI501_RS27300 (OI501_27305) 77573..78043 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
OI501_RS27305 (OI501_27310) 78040..78483 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
OI501_RS27310 (OI501_27315) 78584..79087 - 504 Protein_92 DUF4113 domain-containing protein -
OI501_RS27315 (OI501_27320) 79293..80273 - 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
OI501_RS27320 (OI501_27325) 80339..81646 + 1308 Protein_94 FepA family TonB-dependent siderophore receptor -
OI501_RS27325 (OI501_27330) 81708..81929 + 222 WP_004213615.1 hypothetical protein -
OI501_RS27330 (OI501_27335) 82273..83235 - 963 WP_004902373.1 DEAD/DEAH box helicase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..192941 192941
- inside IScluster/Tn - iroN 71292..84884 13592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T262594 WP_004026354.1 NZ_CP109974:c78043-77573 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT262594 WP_004026357.1 NZ_CP109974:c78483-78040 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References