Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4160722..4161341 | Replicon | chromosome |
Accession | NZ_CP109973 | ||
Organism | Klebsiella pneumoniae strain 857 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OI501_RS20695 | Protein ID | WP_002892050.1 |
Coordinates | 4161123..4161341 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | OI501_RS20690 | Protein ID | WP_002892066.1 |
Coordinates | 4160722..4161096 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI501_RS20680 (OI501_20685) | 4155874..4157067 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OI501_RS20685 (OI501_20690) | 4157090..4160236 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OI501_RS20690 (OI501_20695) | 4160722..4161096 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
OI501_RS20695 (OI501_20700) | 4161123..4161341 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OI501_RS20700 (OI501_20705) | 4161500..4162066 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
OI501_RS20705 (OI501_20710) | 4162038..4162178 | - | 141 | WP_004147370.1 | hypothetical protein | - |
OI501_RS20710 (OI501_20715) | 4162199..4162669 | + | 471 | WP_002892026.1 | YlaC family protein | - |
OI501_RS20715 (OI501_20720) | 4162644..4164095 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
OI501_RS20720 (OI501_20725) | 4164196..4164894 | + | 699 | WP_002892021.1 | GNAT family protein | - |
OI501_RS20725 (OI501_20730) | 4164891..4165031 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
OI501_RS20730 (OI501_20735) | 4165031..4165294 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T262587 WP_002892050.1 NZ_CP109973:4161123-4161341 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT262587 WP_002892066.1 NZ_CP109973:4160722-4161096 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |