Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 3339153..3339784 | Replicon | chromosome |
Accession | NZ_CP109973 | ||
Organism | Klebsiella pneumoniae strain 857 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
Locus tag | OI501_RS16755 | Protein ID | WP_012542177.1 |
Coordinates | 3339608..3339784 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A3Q9U6R4 |
Locus tag | OI501_RS16750 | Protein ID | WP_017898984.1 |
Coordinates | 3339153..3339560 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI501_RS16715 (OI501_16720) | 3334517..3334951 | - | 435 | WP_012542168.1 | phage terminase small subunit P27 family | - |
OI501_RS16720 (OI501_16725) | 3335199..3335630 | - | 432 | WP_023279521.1 | hypothetical protein | - |
OI501_RS16725 (OI501_16730) | 3335627..3335944 | - | 318 | WP_023279522.1 | hypothetical protein | - |
OI501_RS16730 (OI501_16735) | 3335896..3336258 | - | 363 | WP_014228901.1 | HNH endonuclease | - |
OI501_RS16735 (OI501_16740) | 3337383..3337733 | - | 351 | WP_017898986.1 | hypothetical protein | - |
OI501_RS16740 (OI501_16745) | 3337730..3338227 | - | 498 | WP_023279523.1 | lysozyme | - |
OI501_RS16745 (OI501_16750) | 3338227..3338442 | - | 216 | WP_017880269.1 | class II holin family protein | - |
OI501_RS16750 (OI501_16755) | 3339153..3339560 | - | 408 | WP_017898984.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OI501_RS16755 (OI501_16760) | 3339608..3339784 | - | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OI501_RS16760 (OI501_16765) | 3340148..3341932 | + | 1785 | WP_032415155.1 | ATP-binding protein | - |
OI501_RS16765 (OI501_16770) | 3341952..3342986 | + | 1035 | WP_219071718.1 | DNA cytosine methyltransferase | - |
OI501_RS16770 (OI501_16775) | 3343011..3343352 | - | 342 | WP_017898982.1 | antiterminator Q family protein | - |
OI501_RS16775 (OI501_16780) | 3343365..3344396 | - | 1032 | WP_071058942.1 | DUF968 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3305684..3363195 | 57511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T262586 WP_012542177.1 NZ_CP109973:c3339784-3339608 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14959.96 Da Isoelectric Point: 4.4277
>AT262586 WP_017898984.1 NZ_CP109973:c3339560-3339153 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YTV3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Q9U6R4 |