Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF-MazE |
Location | 580286..580911 | Replicon | chromosome |
Accession | NZ_CP109968 | ||
Organism | Agrobacterium salinitolerans strain CFBP5507 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | CFBP5507_RS02825 | Protein ID | WP_137409966.1 |
Coordinates | 580552..580911 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A420FBH4 |
Locus tag | CFBP5507_RS02820 | Protein ID | WP_059753836.1 |
Coordinates | 580286..580552 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP5507_RS02800 (CFBP5507_02800) | 575762..576586 | + | 825 | WP_137410972.1 | class D beta-lactamase | - |
CFBP5507_RS02805 (CFBP5507_02805) | 576963..579545 | + | 2583 | WP_170985460.1 | heavy metal translocating P-type ATPase | - |
CFBP5507_RS02810 (CFBP5507_02810) | 579542..579964 | + | 423 | WP_137409965.1 | Cu(I)-responsive transcriptional regulator | - |
CFBP5507_RS02815 (CFBP5507_02815) | 580017..580217 | + | 201 | WP_080791105.1 | heavy-metal-associated domain-containing protein | - |
CFBP5507_RS02820 (CFBP5507_02820) | 580286..580552 | + | 267 | WP_059753836.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
CFBP5507_RS02825 (CFBP5507_02825) | 580552..580911 | + | 360 | WP_137409966.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CFBP5507_RS02830 (CFBP5507_02830) | 580932..581180 | - | 249 | WP_077982678.1 | hypothetical protein | - |
CFBP5507_RS02835 (CFBP5507_02835) | 581358..582746 | + | 1389 | WP_170985565.1 | MFS transporter | - |
CFBP5507_RS02840 (CFBP5507_02840) | 582822..582995 | - | 174 | WP_077982677.1 | hypothetical protein | - |
CFBP5507_RS02845 (CFBP5507_02845) | 583064..584779 | - | 1716 | WP_137409968.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 12910.10 Da Isoelectric Point: 9.2810
>T262575 WP_137409966.1 NZ_CP109968:580552-580911 [Agrobacterium salinitolerans]
MVRSQVPKRGDVYLVDLNPVIGSEIRDEHRCIVITPREINAVGLCLVVPVNTGGLFTRRAGLAVNISGHKTTGVALCNQV
RSMDIVARASQKKAKYIETLDDATIDKIVGRVISMIDPA
MVRSQVPKRGDVYLVDLNPVIGSEIRDEHRCIVITPREINAVGLCLVVPVNTGGLFTRRAGLAVNISGHKTTGVALCNQV
RSMDIVARASQKKAKYIETLDDATIDKIVGRVISMIDPA
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|