Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 328064..328544 | Replicon | chromosome |
Accession | NZ_CP109968 | ||
Organism | Agrobacterium salinitolerans strain CFBP5507 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | CFBP5507_RS01565 | Protein ID | WP_137409826.1 |
Coordinates | 328064..328333 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | CFBP5507_RS01570 | Protein ID | WP_077983309.1 |
Coordinates | 328317..328544 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP5507_RS01535 (CFBP5507_01535) | 323128..323904 | - | 777 | WP_137409822.1 | L,D-transpeptidase | - |
CFBP5507_RS01540 (CFBP5507_01540) | 324140..324769 | + | 630 | WP_077983316.1 | DNA-3-methyladenine glycosylase I | - |
CFBP5507_RS01545 (CFBP5507_01545) | 324766..325209 | + | 444 | WP_137409823.1 | hypothetical protein | - |
CFBP5507_RS01550 (CFBP5507_01550) | 325225..326268 | - | 1044 | WP_089153242.1 | YeiH family protein | - |
CFBP5507_RS01555 (CFBP5507_01555) | 326350..327267 | + | 918 | WP_137409824.1 | LysR substrate-binding domain-containing protein | - |
CFBP5507_RS01560 (CFBP5507_01560) | 327293..328057 | - | 765 | WP_137409825.1 | hypothetical protein | - |
CFBP5507_RS01565 (CFBP5507_01565) | 328064..328333 | - | 270 | WP_137409826.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CFBP5507_RS01570 (CFBP5507_01570) | 328317..328544 | - | 228 | WP_077983309.1 | DUF6290 family protein | Antitoxin |
CFBP5507_RS01575 (CFBP5507_01575) | 328781..330304 | + | 1524 | WP_137409827.1 | histidine--tRNA ligase | - |
CFBP5507_RS01580 (CFBP5507_01580) | 330309..330677 | + | 369 | WP_137409828.1 | VOC family protein | - |
CFBP5507_RS01585 (CFBP5507_01585) | 330694..331821 | + | 1128 | WP_137409829.1 | ATP phosphoribosyltransferase regulatory subunit | - |
CFBP5507_RS01590 (CFBP5507_01590) | 331818..332510 | + | 693 | WP_137409830.1 | ATP phosphoribosyltransferase | - |
CFBP5507_RS01595 (CFBP5507_01595) | 332569..333015 | - | 447 | WP_137409831.1 | DoxX family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10713.34 Da Isoelectric Point: 9.8259
>T262574 WP_137409826.1 NZ_CP109968:c328333-328064 [Agrobacterium salinitolerans]
VIWTIEYHTLVQKEMRKINPEVRRRIRSFLHERPAALDDPRQTGAALQGSELGNYWRYRVGDYRIICDIQDHKLVVLVVE
IGHRREIYR
VIWTIEYHTLVQKEMRKINPEVRRRIRSFLHERPAALDDPRQTGAALQGSELGNYWRYRVGDYRIICDIQDHKLVVLVVE
IGHRREIYR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|