Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 181630..182174 | Replicon | plasmid pCadTS8_1 |
| Accession | NZ_CP109966 | ||
| Organism | Catenovulum sp. TS8 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OLW01_RS14580 | Protein ID | WP_268076665.1 |
| Coordinates | 181875..182174 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OLW01_RS14575 | Protein ID | WP_268076664.1 |
| Coordinates | 181630..181887 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLW01_RS14550 (OLW01_14550) | 177768..178151 | + | 384 | WP_268076660.1 | hypothetical protein | - |
| OLW01_RS14555 (OLW01_14555) | 178371..178883 | + | 513 | WP_268076661.1 | group II intron maturase-specific domain-containing protein | - |
| OLW01_RS14560 (OLW01_14560) | 179061..179327 | + | 267 | WP_268076662.1 | BrnT family toxin | - |
| OLW01_RS14565 (OLW01_14565) | 179314..179559 | + | 246 | WP_268076663.1 | CopG family transcriptional regulator | - |
| OLW01_RS14570 (OLW01_14570) | 180651..181448 | - | 798 | WP_268076744.1 | IS30 family transposase | - |
| OLW01_RS14575 (OLW01_14575) | 181630..181887 | + | 258 | WP_268076664.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OLW01_RS14580 (OLW01_14580) | 181875..182174 | + | 300 | WP_268076665.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OLW01_RS14585 (OLW01_14585) | 182221..182655 | - | 435 | Protein_112 | IS3 family transposase | - |
| OLW01_RS14590 (OLW01_14590) | 182886..184364 | + | 1479 | WP_268076666.1 | BNR-4 repeat-containing protein | - |
| OLW01_RS14595 (OLW01_14595) | 184769..186217 | - | 1449 | WP_268076667.1 | sel1 repeat family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..672341 | 672341 | |
| - | flank | IS/Tn | - | - | 182221..182652 | 431 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11620.37 Da Isoelectric Point: 8.0200
>T262572 WP_268076665.1 NZ_CP109966:181875-182174 [Catenovulum sp. TS8]
MAEIIWTEPALNDLNEIAEYIALSNLTAAKNLTQKVFNKISRLENHPESGKVPSELKGFSYREVVVNPCRVFYKLENNQV
YILHVMRQERDLRRFLLQN
MAEIIWTEPALNDLNEIAEYIALSNLTAAKNLTQKVFNKISRLENHPESGKVPSELKGFSYREVVVNPCRVFYKLENNQV
YILHVMRQERDLRRFLLQN
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|