Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 95518..96161 Replicon plasmid pNY13307-1
Accession NZ_CP109964
Organism Klebsiella pneumoniae isolate NY13307

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OJ970_RS26020 Protein ID WP_001044770.1
Coordinates 95518..95934 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OJ970_RS26025 Protein ID WP_001261282.1
Coordinates 95931..96161 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OJ970_RS26000 (OJ970_26005) 91621..91893 - 273 Protein_116 transposase -
OJ970_RS26010 (OJ970_26015) 92875..93897 - 1023 WP_000361404.1 helicase UvrD -
OJ970_RS26015 (OJ970_26020) 93882..95444 - 1563 WP_004206609.1 AAA family ATPase -
OJ970_RS26020 (OJ970_26025) 95518..95934 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OJ970_RS26025 (OJ970_26030) 95931..96161 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OJ970_RS26030 (OJ970_26035) 96118..96579 + 462 WP_160866775.1 hypothetical protein -
OJ970_RS26035 (OJ970_26040) 96749..96967 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
OJ970_RS26040 (OJ970_26045) 96969..97274 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
OJ970_RS26045 (OJ970_26050) 97443..97838 + 396 WP_017899885.1 hypothetical protein -
OJ970_RS26050 (OJ970_26055) 97865..98179 + 315 WP_053389906.1 hypothetical protein -
OJ970_RS26055 (OJ970_26060) 98190..99206 + 1017 WP_017899884.1 hypothetical protein -
OJ970_RS26060 (OJ970_26065) 99404..100198 + 795 WP_004197635.1 site-specific integrase -
OJ970_RS26065 (OJ970_26070) 100654..100956 - 303 WP_004197636.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / sul1 / qacE / dfrA25 - 1..178868 178868


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T262566 WP_001044770.1 NZ_CP109964:c95934-95518 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT262566 WP_001261282.1 NZ_CP109964:c96161-95931 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References