Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3901463..3902082 Replicon chromosome
Accession NZ_CP109963
Organism Klebsiella pneumoniae isolate NY13307

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OJ970_RS19300 Protein ID WP_002892050.1
Coordinates 3901864..3902082 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OJ970_RS19295 Protein ID WP_002892066.1
Coordinates 3901463..3901837 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OJ970_RS19285 (OJ970_19290) 3896615..3897808 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OJ970_RS19290 (OJ970_19295) 3897831..3900977 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OJ970_RS19295 (OJ970_19300) 3901463..3901837 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OJ970_RS19300 (OJ970_19305) 3901864..3902082 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OJ970_RS19305 (OJ970_19310) 3902241..3902807 + 567 WP_002892030.1 maltose O-acetyltransferase -
OJ970_RS19310 (OJ970_19315) 3902779..3902919 - 141 WP_004147370.1 hypothetical protein -
OJ970_RS19315 (OJ970_19320) 3902940..3903410 + 471 WP_002892026.1 YlaC family protein -
OJ970_RS19320 (OJ970_19325) 3903385..3904836 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OJ970_RS19325 (OJ970_19330) 3904937..3905635 + 699 WP_002892021.1 GNAT family protein -
OJ970_RS19330 (OJ970_19335) 3905632..3905772 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OJ970_RS19335 (OJ970_19340) 3905772..3906035 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T262560 WP_002892050.1 NZ_CP109963:3901864-3902082 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT262560 WP_002892066.1 NZ_CP109963:3901463-3901837 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References