Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 194713..195238 | Replicon | plasmid p3 |
Accession | NZ_CP109956 | ||
Organism | Escherichia coli strain NC22 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | OI124_RS26080 | Protein ID | WP_001159871.1 |
Coordinates | 194933..195238 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | OI124_RS26075 | Protein ID | WP_000813630.1 |
Coordinates | 194713..194931 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI124_RS26065 (190939) | 190939..191415 | - | 477 | Protein_199 | IS256 family transposase | - |
OI124_RS26070 (191472) | 191472..194153 | - | 2682 | WP_000678689.1 | hypothetical protein | - |
OI124_RS26075 (194713) | 194713..194931 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
OI124_RS26080 (194933) | 194933..195238 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
OI124_RS26085 (195239) | 195239..196045 | + | 807 | WP_000016968.1 | site-specific integrase | - |
OI124_RS26090 (196725) | 196725..197456 | - | 732 | WP_000504262.1 | replication initiation protein | - |
OI124_RS26095 (198077) | 198077..199282 | + | 1206 | WP_001442122.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..255823 | 255823 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T262546 WP_001159871.1 NZ_CP109956:194933-195238 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |