Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 100609..101252 Replicon plasmid p3
Accession NZ_CP109956
Organism Escherichia coli strain NC22

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag OI124_RS25555 Protein ID WP_001034046.1
Coordinates 100609..101025 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag OI124_RS25560 Protein ID WP_001261278.1
Coordinates 101022..101252 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI124_RS25540 (95746) 95746..96162 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
OI124_RS25545 (96159) 96159..96389 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
OI124_RS25550 (96770) 96770..100564 + 3795 WP_001144732.1 hypothetical protein -
OI124_RS25555 (100609) 100609..101025 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
OI124_RS25560 (101022) 101022..101252 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OI124_RS25565 (101517) 101517..102017 + 501 WP_000528932.1 HEPN family nuclease -
OI124_RS25570 (102030) 102030..102803 + 774 WP_000905949.1 hypothetical protein -
OI124_RS25575 (102970) 102970..104103 + 1134 WP_000545986.1 DUF3800 domain-containing protein -
OI124_RS25580 (104137) 104137..104625 - 489 WP_011254646.1 hypothetical protein -
OI124_RS25585 (105167) 105167..105580 + 414 WP_000465036.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA 1..255823 255823


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T262540 WP_001034046.1 NZ_CP109956:c101025-100609 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT262540 WP_001261278.1 NZ_CP109956:c101252-101022 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References