Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 95746..96389 Replicon plasmid p3
Accession NZ_CP109956
Organism Escherichia coli strain NC22

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag OI124_RS25540 Protein ID WP_001034044.1
Coordinates 95746..96162 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag OI124_RS25545 Protein ID WP_001261286.1
Coordinates 96159..96389 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI124_RS25520 (90877) 90877..91791 - 915 WP_000949004.1 iron/manganese ABC transporter substrate-binding protein SitA -
OI124_RS25525 (92147) 92147..92844 + 698 WP_223155668.1 IS1-like element IS1A family transposase -
OI124_RS25530 (93099) 93099..94121 - 1023 WP_000361402.1 helicase UvrD -
OI124_RS25535 (94106) 94106..95671 - 1566 WP_001128474.1 AAA family ATPase -
OI124_RS25540 (95746) 95746..96162 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
OI124_RS25545 (96159) 96159..96389 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OI124_RS25550 (96770) 96770..100564 + 3795 WP_001144732.1 hypothetical protein -
OI124_RS25555 (100609) 100609..101025 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
OI124_RS25560 (101022) 101022..101252 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA 1..255823 255823
- flank IS/Tn sitABCD - 88342..92844 4502


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T262539 WP_001034044.1 NZ_CP109956:c96162-95746 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT262539 WP_001261286.1 NZ_CP109956:c96389-96159 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References