262538

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 180807..181300 Replicon plasmid p2
Accession NZ_CP109955
Organism Escherichia coli strain NC22

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag OI124_RS24755 Protein ID WP_001230709.1
Coordinates 180807..181061 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag OI124_RS24760 Protein ID WP_000151456.1
Coordinates 181058..181300 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI124_RS24720 (OI124_24640) 175940..176200 - 261 WP_001424629.1 hypothetical protein -
OI124_RS24725 (OI124_24645) 176396..176788 - 393 WP_000843244.1 hypothetical protein -
OI124_RS24730 (OI124_24650) 176813..177562 - 750 WP_000720274.1 thioredoxin fold domain-containing protein -
OI124_RS24735 (OI124_24655) 177710..178249 + 540 WP_000494967.1 lytic transglycosylase domain-containing protein -
OI124_RS24740 (OI124_24660) 178332..178898 + 567 WP_024136329.1 HAD domain-containing protein -
OI124_RS24745 (OI124_24665) 179006..180193 - 1188 WP_223602005.1 HNH endonuclease signature motif containing protein -
OI124_RS24750 (OI124_24670) 180268..180810 + 543 WP_001083904.1 hypothetical protein -
OI124_RS24755 (OI124_24675) 180807..181061 + 255 WP_001230709.1 hypothetical protein Toxin
OI124_RS24760 (OI124_24680) 181058..181300 + 243 WP_000151456.1 hypothetical protein Antitoxin
OI124_RS24765 (OI124_24685) 181425..181769 + 345 Protein_183 WbuC family cupin fold metalloprotein -
OI124_RS24770 (OI124_24690) 181816..182691 - 876 WP_032492042.1 extended-spectrum class A beta-lactamase CTX-M-64 -
OI124_RS24775 (OI124_24695) 182944..184197 - 1254 WP_278140744.1 IS1380-like element ISEcp1 family transposase -
OI124_RS24780 (OI124_24700) 184321..185301 - 981 WP_000019441.1 IS5-like element ISKpn26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / oqxA / oqxB / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / mph(A) / aph(3')-Ia / aac(3)-IIa / blaCTX-M-64 - 1..234214 234214


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T262538 WP_001230709.1 NZ_CP109955:180807-181061 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT262538 WP_000151456.1 NZ_CP109955:181058-181300 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References