Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4577750..4578404 | Replicon | chromosome |
Accession | NZ_CP109953 | ||
Organism | Escherichia coli strain NC22 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | OI124_RS22300 | Protein ID | WP_000244777.1 |
Coordinates | 4577997..4578404 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | OI124_RS22295 | Protein ID | WP_000354046.1 |
Coordinates | 4577750..4578016 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI124_RS22270 (4573038) | 4573038..4573781 | + | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
OI124_RS22275 (4573838) | 4573838..4575271 | - | 1434 | Protein_4340 | 6-phospho-beta-glucosidase BglA | - |
OI124_RS22280 (4575316) | 4575316..4575627 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
OI124_RS22285 (4575791) | 4575791..4576450 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
OI124_RS22290 (4576527) | 4576527..4577507 | - | 981 | WP_000886061.1 | tRNA-modifying protein YgfZ | - |
OI124_RS22295 (4577750) | 4577750..4578016 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
OI124_RS22300 (4577997) | 4577997..4578404 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
OI124_RS22305 (4578444) | 4578444..4578965 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
OI124_RS22310 (4579077) | 4579077..4579973 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
OI124_RS22315 (4579998) | 4579998..4580708 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OI124_RS22320 (4580714) | 4580714..4582447 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T262534 WP_000244777.1 NZ_CP109953:4577997-4578404 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |