Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2340559..2341177 | Replicon | chromosome |
| Accession | NZ_CP109953 | ||
| Organism | Escherichia coli strain NC22 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | OI124_RS11390 | Protein ID | WP_001291435.1 |
| Coordinates | 2340959..2341177 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | OI124_RS11385 | Protein ID | WP_000344800.1 |
| Coordinates | 2340559..2340933 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI124_RS11375 (2335648) | 2335648..2336841 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OI124_RS11380 (2336864) | 2336864..2340013 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| OI124_RS11385 (2340559) | 2340559..2340933 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| OI124_RS11390 (2340959) | 2340959..2341177 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| OI124_RS11395 (2341349) | 2341349..2341900 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| OI124_RS11400 (2342016) | 2342016..2342486 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| OI124_RS11405 (2342650) | 2342650..2344200 | + | 1551 | WP_048943370.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| OI124_RS11410 (2344242) | 2344242..2344595 | - | 354 | Protein_2226 | DUF1428 family protein | - |
| OI124_RS11420 (2344974) | 2344974..2345285 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| OI124_RS11425 (2345316) | 2345316..2345888 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T262527 WP_001291435.1 NZ_CP109953:2340959-2341177 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT262527 WP_000344800.1 NZ_CP109953:2340559-2340933 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |