Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 133907..134532 | Replicon | chromosome |
Accession | NZ_CP109953 | ||
Organism | Escherichia coli strain NC22 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OI124_RS00615 | Protein ID | WP_000911330.1 |
Coordinates | 134134..134532 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | OI124_RS00610 | Protein ID | WP_000450524.1 |
Coordinates | 133907..134134 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI124_RS00585 (129710) | 129710..130180 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
OI124_RS00590 (130180) | 130180..130752 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
OI124_RS00595 (130898) | 130898..131776 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
OI124_RS00600 (131793) | 131793..132827 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
OI124_RS00605 (133040) | 133040..133753 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
OI124_RS00610 (133907) | 133907..134134 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
OI124_RS00615 (134134) | 134134..134532 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OI124_RS00620 (134679) | 134679..135542 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
OI124_RS00625 (135557) | 135557..137572 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
OI124_RS00630 (137646) | 137646..138344 | + | 699 | WP_000679823.1 | esterase | - |
OI124_RS00635 (138454) | 138454..138654 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T262520 WP_000911330.1 NZ_CP109953:134134-134532 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|