Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 9725..10305 | Replicon | plasmid pKP1650-4 |
Accession | NZ_CP109952 | ||
Organism | Klebsiella pneumoniae strain KP1650 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | OIS41_RS29250 | Protein ID | WP_071177730.1 |
Coordinates | 9725..10039 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | OIS41_RS29255 | Protein ID | WP_000093040.1 |
Coordinates | 10027..10305 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIS41_RS29225 (OIS41_29230) | 5669..7633 | + | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
OIS41_RS29230 (OIS41_29235) | 7633..8364 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
OIS41_RS29235 (OIS41_29240) | 8371..8901 | + | 531 | WP_071177729.1 | hypothetical protein | - |
OIS41_RS29240 (OIS41_29245) | 8928..9107 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
OIS41_RS29245 (OIS41_29250) | 9133..9561 | - | 429 | WP_001140599.1 | hypothetical protein | - |
OIS41_RS29250 (OIS41_29255) | 9725..10039 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OIS41_RS29255 (OIS41_29260) | 10027..10305 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
OIS41_RS29260 (OIS41_29265) | 10480..10845 | - | 366 | WP_072354022.1 | TonB family protein | - |
OIS41_RS29265 (OIS41_29270) | 10842..11213 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
OIS41_RS29270 (OIS41_29275) | 11487..11732 | - | 246 | WP_032440458.1 | hypothetical protein | - |
OIS41_RS29275 (OIS41_29280) | 12377..13864 | + | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..23943 | 23943 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T262519 WP_071177730.1 NZ_CP109952:c10039-9725 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|