Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 169541..170451 | Replicon | plasmid pKP1650-1 |
Accession | NZ_CP109949 | ||
Organism | Klebsiella pneumoniae strain KP1650 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A663AYG0 |
Locus tag | OIS41_RS27645 | Protein ID | WP_004026354.1 |
Coordinates | 169541..170011 (-) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A6P1V3Q9 |
Locus tag | OIS41_RS27650 | Protein ID | WP_004026357.1 |
Coordinates | 170008..170451 (-) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIS41_RS27605 (OIS41_27610) | 164857..165171 | + | 315 | WP_011251273.1 | hypothetical protein | - |
OIS41_RS27610 (OIS41_27615) | 165180..165674 | + | 495 | WP_011251274.1 | hypothetical protein | - |
OIS41_RS27615 (OIS41_27620) | 165680..166120 | + | 441 | WP_011251275.1 | hypothetical protein | - |
OIS41_RS27620 (OIS41_27625) | 166545..167501 | - | 957 | WP_011251280.1 | DsbA family protein | - |
OIS41_RS27625 (OIS41_27630) | 167561..167902 | - | 342 | WP_011251281.1 | hypothetical protein | - |
OIS41_RS27630 (OIS41_27635) | 167916..168227 | - | 312 | WP_011251282.1 | hypothetical protein | - |
OIS41_RS27635 (OIS41_27640) | 168244..168693 | - | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
OIS41_RS27645 (OIS41_27650) | 169541..170011 | - | 471 | WP_004026354.1 | RES family NAD+ phosphorylase | Toxin |
OIS41_RS27650 (OIS41_27655) | 170008..170451 | - | 444 | WP_004026357.1 | DUF2384 domain-containing protein | Antitoxin |
OIS41_RS27655 (OIS41_27660) | 170552..171055 | - | 504 | Protein_189 | DUF4113 domain-containing protein | - |
OIS41_RS27660 (OIS41_27665) | 171261..172241 | - | 981 | WP_000019473.1 | IS5-like element ISKpn26 family transposase | - |
OIS41_RS27665 (OIS41_27670) | 172307..173614 | + | 1308 | Protein_191 | FepA family TonB-dependent siderophore receptor | - |
OIS41_RS27670 (OIS41_27675) | 173676..173897 | + | 222 | WP_004213615.1 | hypothetical protein | - |
OIS41_RS27675 (OIS41_27680) | 174241..175203 | - | 963 | WP_004902373.1 | DEAD/DEAH box helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iutA / rmpA2 / iroN / iucA / iucB / iucC / iucD | 1..194879 | 194879 | |
- | inside | IScluster/Tn | - | iroN | 163260..176852 | 13592 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17515.79 Da Isoelectric Point: 4.6155
>T262508 WP_004026354.1 NZ_CP109949:c170011-169541 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16480.80 Da Isoelectric Point: 10.2498
>AT262508 WP_004026357.1 NZ_CP109949:c170451-170008 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A663AYG0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6P1V3Q9 |