Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 169541..170451 Replicon plasmid pKP1650-1
Accession NZ_CP109949
Organism Klebsiella pneumoniae strain KP1650

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag OIS41_RS27645 Protein ID WP_004026354.1
Coordinates 169541..170011 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag OIS41_RS27650 Protein ID WP_004026357.1
Coordinates 170008..170451 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIS41_RS27605 (OIS41_27610) 164857..165171 + 315 WP_011251273.1 hypothetical protein -
OIS41_RS27610 (OIS41_27615) 165180..165674 + 495 WP_011251274.1 hypothetical protein -
OIS41_RS27615 (OIS41_27620) 165680..166120 + 441 WP_011251275.1 hypothetical protein -
OIS41_RS27620 (OIS41_27625) 166545..167501 - 957 WP_011251280.1 DsbA family protein -
OIS41_RS27625 (OIS41_27630) 167561..167902 - 342 WP_011251281.1 hypothetical protein -
OIS41_RS27630 (OIS41_27635) 167916..168227 - 312 WP_011251282.1 hypothetical protein -
OIS41_RS27635 (OIS41_27640) 168244..168693 - 450 WP_011251283.1 thioredoxin fold domain-containing protein -
OIS41_RS27645 (OIS41_27650) 169541..170011 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
OIS41_RS27650 (OIS41_27655) 170008..170451 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
OIS41_RS27655 (OIS41_27660) 170552..171055 - 504 Protein_189 DUF4113 domain-containing protein -
OIS41_RS27660 (OIS41_27665) 171261..172241 - 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
OIS41_RS27665 (OIS41_27670) 172307..173614 + 1308 Protein_191 FepA family TonB-dependent siderophore receptor -
OIS41_RS27670 (OIS41_27675) 173676..173897 + 222 WP_004213615.1 hypothetical protein -
OIS41_RS27675 (OIS41_27680) 174241..175203 - 963 WP_004902373.1 DEAD/DEAH box helicase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iutA / rmpA2 / iroN / iucA / iucB / iucC / iucD 1..194879 194879
- inside IScluster/Tn - iroN 163260..176852 13592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T262508 WP_004026354.1 NZ_CP109949:c170011-169541 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT262508 WP_004026357.1 NZ_CP109949:c170451-170008 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References