Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 104274..104917 | Replicon | plasmid pKP1650-1 |
Accession | NZ_CP109949 | ||
Organism | Klebsiella pneumoniae strain KP1650 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OIS41_RS27285 | Protein ID | WP_001044770.1 |
Coordinates | 104501..104917 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OIS41_RS27280 | Protein ID | WP_001261282.1 |
Coordinates | 104274..104504 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIS41_RS27255 (OIS41_27260) | 100214..100381 | - | 168 | Protein_109 | IS1 family transposase | - |
OIS41_RS27260 (OIS41_27265) | 100685..101614 | + | 930 | WP_004213558.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
OIS41_RS27265 (OIS41_27270) | 101759..102538 | - | 780 | WP_004213560.1 | site-specific integrase | - |
OIS41_RS27270 (OIS41_27275) | 102535..103356 | - | 822 | WP_004213562.1 | hypothetical protein | - |
OIS41_RS27275 (OIS41_27280) | 103901..104317 | - | 417 | WP_264485012.1 | hypothetical protein | - |
OIS41_RS27280 (OIS41_27285) | 104274..104504 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OIS41_RS27285 (OIS41_27290) | 104501..104917 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OIS41_RS27290 (OIS41_27295) | 104991..106553 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
OIS41_RS27295 (OIS41_27300) | 106538..107560 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
OIS41_RS27300 (OIS41_27305) | 107816..108513 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
OIS41_RS27305 (OIS41_27310) | 108542..108814 | + | 273 | Protein_119 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iutA / rmpA2 / iroN / iucA / iucB / iucC / iucD | 1..194879 | 194879 | |
- | inside | IScluster/Tn | - | - | 108136..133159 | 25023 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T262506 WP_001044770.1 NZ_CP109949:104501-104917 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |