Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 104274..104917 Replicon plasmid pKP1650-1
Accession NZ_CP109949
Organism Klebsiella pneumoniae strain KP1650

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OIS41_RS27285 Protein ID WP_001044770.1
Coordinates 104501..104917 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OIS41_RS27280 Protein ID WP_001261282.1
Coordinates 104274..104504 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIS41_RS27255 (OIS41_27260) 100214..100381 - 168 Protein_109 IS1 family transposase -
OIS41_RS27260 (OIS41_27265) 100685..101614 + 930 WP_004213558.1 Rpn family recombination-promoting nuclease/putative transposase -
OIS41_RS27265 (OIS41_27270) 101759..102538 - 780 WP_004213560.1 site-specific integrase -
OIS41_RS27270 (OIS41_27275) 102535..103356 - 822 WP_004213562.1 hypothetical protein -
OIS41_RS27275 (OIS41_27280) 103901..104317 - 417 WP_264485012.1 hypothetical protein -
OIS41_RS27280 (OIS41_27285) 104274..104504 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OIS41_RS27285 (OIS41_27290) 104501..104917 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OIS41_RS27290 (OIS41_27295) 104991..106553 + 1563 WP_004206609.1 AAA family ATPase -
OIS41_RS27295 (OIS41_27300) 106538..107560 + 1023 WP_000361404.1 helicase UvrD -
OIS41_RS27300 (OIS41_27305) 107816..108513 + 698 WP_223174630.1 IS1 family transposase -
OIS41_RS27305 (OIS41_27310) 108542..108814 + 273 Protein_119 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iutA / rmpA2 / iroN / iucA / iucB / iucC / iucD 1..194879 194879
- inside IScluster/Tn - - 108136..133159 25023


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T262506 WP_001044770.1 NZ_CP109949:104501-104917 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT262506 WP_001261282.1 NZ_CP109949:104274-104504 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References