262505

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 8373..9043 Replicon plasmid pKP1650-1
Accession NZ_CP109949
Organism Klebsiella pneumoniae strain KP1650

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag OIS41_RS26765 Protein ID WP_004213072.1
Coordinates 8373..8816 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag OIS41_RS26770 Protein ID WP_004213073.1
Coordinates 8813..9043 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIS41_RS26730 (OIS41_26735) 3784..4059 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
OIS41_RS26735 (OIS41_26740) 4122..4613 + 492 WP_011251327.1 DM13 domain-containing protein -
OIS41_RS26740 (OIS41_26745) 4662..5582 + 921 WP_004213934.1 DUF1471 domain-containing protein -
OIS41_RS26745 (OIS41_26750) 5673..6076 + 404 Protein_7 GAF domain-containing protein -
OIS41_RS26750 (OIS41_26755) 6594..7229 - 636 Protein_8 mucoid phenotype regulator RmpA2 -
OIS41_RS26755 (OIS41_26760) 7646..7950 + 305 Protein_9 transposase -
OIS41_RS26760 (OIS41_26765) 7973..8224 - 252 WP_186987481.1 hypothetical protein -
OIS41_RS26765 (OIS41_26770) 8373..8816 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
OIS41_RS26770 (OIS41_26775) 8813..9043 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OIS41_RS26775 (OIS41_26780) 9651..10784 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
OIS41_RS26780 (OIS41_26785) 10800..11093 + 294 WP_004213076.1 hypothetical protein -
OIS41_RS26785 (OIS41_26790) 11083..11289 - 207 WP_004213077.1 hypothetical protein -
OIS41_RS26790 (OIS41_26795) 11641..11931 + 291 WP_004213078.1 hypothetical protein -
OIS41_RS26795 (OIS41_26800) 11921..12820 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iutA / rmpA2 / iroN / iucA / iucB / iucC / iucD 1..194879 194879


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T262505 WP_004213072.1 NZ_CP109949:c8816-8373 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT262505 WP_004213073.1 NZ_CP109949:c9043-8813 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References