Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4152235..4152854 | Replicon | chromosome |
Accession | NZ_CP109948 | ||
Organism | Klebsiella pneumoniae strain KP1650 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OIS41_RS20555 | Protein ID | WP_002892050.1 |
Coordinates | 4152636..4152854 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | OIS41_RS20550 | Protein ID | WP_002892066.1 |
Coordinates | 4152235..4152609 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIS41_RS20540 (OIS41_20545) | 4147387..4148580 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OIS41_RS20545 (OIS41_20550) | 4148603..4151749 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OIS41_RS20550 (OIS41_20555) | 4152235..4152609 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
OIS41_RS20555 (OIS41_20560) | 4152636..4152854 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OIS41_RS20560 (OIS41_20565) | 4153013..4153579 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
OIS41_RS20565 (OIS41_20570) | 4153551..4153691 | - | 141 | WP_004147370.1 | hypothetical protein | - |
OIS41_RS20570 (OIS41_20575) | 4153712..4154182 | + | 471 | WP_002892026.1 | YlaC family protein | - |
OIS41_RS20575 (OIS41_20580) | 4154157..4155608 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
OIS41_RS20580 (OIS41_20585) | 4155709..4156407 | + | 699 | WP_002892021.1 | GNAT family protein | - |
OIS41_RS20585 (OIS41_20590) | 4156404..4156544 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
OIS41_RS20590 (OIS41_20595) | 4156544..4156807 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T262500 WP_002892050.1 NZ_CP109948:4152636-4152854 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT262500 WP_002892066.1 NZ_CP109948:4152235-4152609 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |