Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4152235..4152854 Replicon chromosome
Accession NZ_CP109948
Organism Klebsiella pneumoniae strain KP1650

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OIS41_RS20555 Protein ID WP_002892050.1
Coordinates 4152636..4152854 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OIS41_RS20550 Protein ID WP_002892066.1
Coordinates 4152235..4152609 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIS41_RS20540 (OIS41_20545) 4147387..4148580 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OIS41_RS20545 (OIS41_20550) 4148603..4151749 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OIS41_RS20550 (OIS41_20555) 4152235..4152609 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OIS41_RS20555 (OIS41_20560) 4152636..4152854 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OIS41_RS20560 (OIS41_20565) 4153013..4153579 + 567 WP_002892030.1 maltose O-acetyltransferase -
OIS41_RS20565 (OIS41_20570) 4153551..4153691 - 141 WP_004147370.1 hypothetical protein -
OIS41_RS20570 (OIS41_20575) 4153712..4154182 + 471 WP_002892026.1 YlaC family protein -
OIS41_RS20575 (OIS41_20580) 4154157..4155608 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OIS41_RS20580 (OIS41_20585) 4155709..4156407 + 699 WP_002892021.1 GNAT family protein -
OIS41_RS20585 (OIS41_20590) 4156404..4156544 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OIS41_RS20590 (OIS41_20595) 4156544..4156807 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T262500 WP_002892050.1 NZ_CP109948:4152636-4152854 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT262500 WP_002892066.1 NZ_CP109948:4152235-4152609 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References