Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 2168879..2169510 Replicon chromosome
Accession NZ_CP109948
Organism Klebsiella pneumoniae strain KP1650

Toxin (Protein)


Gene name hicA Uniprot ID A0A1Q8YTV3
Locus tag OIS41_RS10605 Protein ID WP_012542177.1
Coordinates 2168879..2169055 (+) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A3Q9U6R4
Locus tag OIS41_RS10610 Protein ID WP_017898984.1
Coordinates 2169103..2169510 (+) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIS41_RS10585 (OIS41_10585) 2164267..2165298 + 1032 WP_071058942.1 DUF968 domain-containing protein -
OIS41_RS10590 (OIS41_10590) 2165311..2165652 + 342 WP_017898982.1 antiterminator Q family protein -
OIS41_RS10595 (OIS41_10595) 2165677..2166711 - 1035 WP_219071718.1 DNA cytosine methyltransferase -
OIS41_RS10600 (OIS41_10600) 2166731..2168515 - 1785 WP_032415155.1 ATP-binding protein -
OIS41_RS10605 (OIS41_10605) 2168879..2169055 + 177 WP_012542177.1 type II toxin-antitoxin system HicA family toxin Toxin
OIS41_RS10610 (OIS41_10610) 2169103..2169510 + 408 WP_017898984.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OIS41_RS10615 (OIS41_10615) 2170221..2170436 + 216 WP_017880269.1 class II holin family protein -
OIS41_RS10620 (OIS41_10620) 2170436..2170933 + 498 WP_023279523.1 lysozyme -
OIS41_RS10625 (OIS41_10625) 2170930..2171280 + 351 WP_017898986.1 hypothetical protein -
OIS41_RS10630 (OIS41_10630) 2172405..2172767 + 363 WP_014228901.1 HNH endonuclease -
OIS41_RS10635 (OIS41_10635) 2172719..2173036 + 318 WP_023279522.1 hypothetical protein -
OIS41_RS10640 (OIS41_10640) 2173033..2173464 + 432 WP_023279521.1 hypothetical protein -
OIS41_RS10645 (OIS41_10645) 2173712..2174146 + 435 WP_012542168.1 phage terminase small subunit P27 family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2147862..2202979 55117


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-61)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6632.83 Da        Isoelectric Point: 11.0174

>T262494 WP_012542177.1 NZ_CP109948:2168879-2169055 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK

Download         Length: 177 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14959.96 Da        Isoelectric Point: 4.4277

>AT262494 WP_017898984.1 NZ_CP109948:2169103-2169510 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q8YTV3

Antitoxin

Source ID Structure
AlphaFold DB A0A3Q9U6R4

References