Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 883526..884180 | Replicon | chromosome |
| Accession | NZ_CP109948 | ||
| Organism | Klebsiella pneumoniae strain KP1650 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | R4YHX2 |
| Locus tag | OIS41_RS04450 | Protein ID | WP_004144731.1 |
| Coordinates | 883773..884180 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | OIS41_RS04445 | Protein ID | WP_002916312.1 |
| Coordinates | 883526..883792 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIS41_RS04420 (OIS41_04420) | 878682..880115 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| OIS41_RS04425 (OIS41_04425) | 880234..880962 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| OIS41_RS04430 (OIS41_04430) | 881012..881323 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
| OIS41_RS04435 (OIS41_04435) | 881487..882146 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| OIS41_RS04440 (OIS41_04440) | 882297..883280 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| OIS41_RS04445 (OIS41_04445) | 883526..883792 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| OIS41_RS04450 (OIS41_04450) | 883773..884180 | + | 408 | WP_004144731.1 | protein YgfX | Toxin |
| OIS41_RS04455 (OIS41_04455) | 884187..884708 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| OIS41_RS04460 (OIS41_04460) | 884809..885705 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| OIS41_RS04465 (OIS41_04465) | 885728..886441 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OIS41_RS04470 (OIS41_04470) | 886447..888180 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15936.69 Da Isoelectric Point: 11.4778
>T262493 WP_004144731.1 NZ_CP109948:883773-884180 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378E4P6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |