Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2041996..2042600 | Replicon | chromosome |
| Accession | NZ_CP109947 | ||
| Organism | Pectobacterium cacticida strain CFCC10813 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | OI450_RS09415 | Protein ID | WP_264498821.1 |
| Coordinates | 2042214..2042600 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | OI450_RS09410 | Protein ID | WP_142501959.1 |
| Coordinates | 2041996..2042217 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI450_RS09400 (OI450_09400) | 2038049..2040232 | + | 2184 | WP_264498819.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
| OI450_RS09405 (OI450_09405) | 2040463..2041470 | + | 1008 | WP_264498820.1 | hypothetical protein | - |
| OI450_RS09410 (OI450_09410) | 2041996..2042217 | + | 222 | WP_142501959.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OI450_RS09415 (OI450_09415) | 2042214..2042600 | + | 387 | WP_264498821.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OI450_RS09420 (OI450_09420) | 2042705..2044009 | - | 1305 | WP_264498822.1 | type II toxin-antitoxin system HipA family toxin YjjJ | - |
| OI450_RS09425 (OI450_09425) | 2044207..2044494 | + | 288 | WP_264498823.1 | VF530 family protein | - |
| OI450_RS09430 (OI450_09430) | 2044500..2045786 | + | 1287 | WP_264498824.1 | glycoside hydrolase family 10 protein | - |
| OI450_RS09435 (OI450_09435) | 2046053..2047438 | + | 1386 | WP_264498825.1 | diaminobutyrate--2-oxoglutarate transaminase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14474.44 Da Isoelectric Point: 7.3587
>T262489 WP_264498821.1 NZ_CP109947:2042214-2042600 [Pectobacterium cacticida]
MIWVSAQEVIAFHDRILQRFPGVAGLADPGRAQALIYRVQNRVHYEGVTALFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKSVDQLAQCLRERVDNSGN
MIWVSAQEVIAFHDRILQRFPGVAGLADPGRAQALIYRVQNRVHYEGVTALFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKSVDQLAQCLRERVDNSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|