Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 991666..992292 | Replicon | chromosome |
| Accession | NZ_CP109947 | ||
| Organism | Pectobacterium cacticida strain CFCC10813 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | C6DB72 |
| Locus tag | OI450_RS04670 | Protein ID | WP_005976087.1 |
| Coordinates | 991666..991869 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | OI450_RS04675 | Protein ID | WP_264498006.1 |
| Coordinates | 991924..992292 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI450_RS04640 (OI450_04640) | 987128..987466 | + | 339 | WP_264498002.1 | P-II family nitrogen regulator | - |
| OI450_RS04645 (OI450_04645) | 987506..988792 | + | 1287 | WP_264498003.1 | ammonium transporter AmtB | - |
| OI450_RS04650 (OI450_04650) | 988966..989826 | - | 861 | WP_264498872.1 | acyl-CoA thioesterase II | - |
| OI450_RS04655 (OI450_04655) | 990038..990571 | + | 534 | WP_264498004.1 | YbaY family lipoprotein | - |
| OI450_RS04660 (OI450_04660) | 990624..990944 | - | 321 | WP_264498005.1 | MGMT family protein | - |
| OI450_RS04670 (OI450_04670) | 991666..991869 | - | 204 | WP_005976087.1 | HHA domain-containing protein | Toxin |
| OI450_RS04675 (OI450_04675) | 991924..992292 | - | 369 | WP_264498006.1 | Hha toxicity modulator TomB | Antitoxin |
| OI450_RS04680 (OI450_04680) | 992987..993130 | - | 144 | WP_264498007.1 | type B 50S ribosomal protein L36 | - |
| OI450_RS04685 (OI450_04685) | 993147..993395 | - | 249 | WP_264498008.1 | type B 50S ribosomal protein L31 | - |
| OI450_RS04690 (OI450_04690) | 993633..996761 | - | 3129 | WP_264498009.1 | efflux RND transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8145.52 Da Isoelectric Point: 8.9008
>T262486 WP_005976087.1 NZ_CP109947:c991869-991666 [Pectobacterium cacticida]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13989.70 Da Isoelectric Point: 4.3316
>AT262486 WP_264498006.1 NZ_CP109947:c992292-991924 [Pectobacterium cacticida]
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEYIATFVLTFKIKYPNESELSKQVETYL
DDTYVLFGNYGINDAELRRWQKSKTTLFGMFSGENICTPAKS
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINLQLNELIEYIATFVLTFKIKYPNESELSKQVETYL
DDTYVLFGNYGINDAELRRWQKSKTTLFGMFSGENICTPAKS
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|