Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 752159..752819 | Replicon | chromosome |
| Accession | NZ_CP109947 | ||
| Organism | Pectobacterium cacticida strain CFCC10813 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OI450_RS03575 | Protein ID | WP_264497818.1 |
| Coordinates | 752406..752819 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | OI450_RS03570 | Protein ID | WP_264497817.1 |
| Coordinates | 752159..752425 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI450_RS03550 (OI450_03550) | 747687..748994 | + | 1308 | WP_264497813.1 | ABC transporter substrate-binding protein | - |
| OI450_RS03555 (OI450_03555) | 749144..749752 | - | 609 | WP_264497814.1 | HD domain-containing protein | - |
| OI450_RS03560 (OI450_03560) | 750124..750771 | + | 648 | WP_264497815.1 | hemolysin III family protein | - |
| OI450_RS03565 (OI450_03565) | 750922..751923 | - | 1002 | WP_264497816.1 | tRNA-modifying protein YgfZ | - |
| OI450_RS03570 (OI450_03570) | 752159..752425 | + | 267 | WP_264497817.1 | FAD assembly factor SdhE | Antitoxin |
| OI450_RS03575 (OI450_03575) | 752406..752819 | + | 414 | WP_264497818.1 | protein YgfX | Toxin |
| OI450_RS03580 (OI450_03580) | 752885..753820 | + | 936 | WP_264497819.1 | 23S rRNA (adenine(1618)-N(6))-methyltransferase RlmF | - |
| OI450_RS03585 (OI450_03585) | 754112..754183 | + | 72 | WP_264498862.1 | type I toxin-antitoxin system SymE family toxin | - |
| OI450_RS03590 (OI450_03590) | 754258..754506 | - | 249 | WP_264498863.1 | hypothetical protein | - |
| OI450_RS03595 (OI450_03595) | 754856..755020 | - | 165 | Protein_682 | RHS repeat-associated core domain-containing protein | - |
| OI450_RS03600 (OI450_03600) | 755456..755935 | - | 480 | WP_264497820.1 | competence protein ComJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16437.44 Da Isoelectric Point: 11.1579
>T262485 WP_264497818.1 NZ_CP109947:752406-752819 [Pectobacterium cacticida]
VAQWQCDLRVSWRMQLLSLMVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRHGEIALLSETTLDWRQQ
EWRIVKRPWLLKHGVLLSLQAVNGKDRRQLWLASDSMGEDEWRHLRQILLQQKRWAR
VAQWQCDLRVSWRMQLLSLMVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRHGEIALLSETTLDWRQQ
EWRIVKRPWLLKHGVLLSLQAVNGKDRRQLWLASDSMGEDEWRHLRQILLQQKRWAR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|