Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 676904..677646 | Replicon | chromosome |
| Accession | NZ_CP109947 | ||
| Organism | Pectobacterium cacticida strain CFCC10813 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | OI450_RS03180 | Protein ID | WP_264497749.1 |
| Coordinates | 677209..677646 (+) | Length | 146 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | OI450_RS03175 | Protein ID | WP_264497748.1 |
| Coordinates | 676904..677176 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI450_RS03150 (OI450_03150) | 672215..673723 | - | 1509 | WP_264497744.1 | amino acid ABC transporter permease/ATP-binding protein | - |
| OI450_RS03155 (OI450_03155) | 673747..674562 | - | 816 | WP_264497745.1 | transporter substrate-binding domain-containing protein | - |
| OI450_RS03165 (OI450_03165) | 675770..676285 | - | 516 | WP_264497746.1 | GNAT family N-acetyltransferase | - |
| OI450_RS03170 (OI450_03170) | 676287..676553 | - | 267 | WP_264497747.1 | DUF1778 domain-containing protein | - |
| OI450_RS03175 (OI450_03175) | 676904..677176 | + | 273 | WP_264497748.1 | DUF1778 domain-containing protein | Antitoxin |
| OI450_RS03180 (OI450_03180) | 677209..677646 | + | 438 | WP_264497749.1 | GNAT family N-acetyltransferase | Toxin |
| OI450_RS03190 (OI450_03190) | 678508..678990 | - | 483 | WP_264497750.1 | SsrA-binding protein SmpB | - |
| OI450_RS03195 (OI450_03195) | 679145..679591 | + | 447 | WP_264497751.1 | type II toxin-antitoxin system RatA family toxin | - |
| OI450_RS03200 (OI450_03200) | 679572..679862 | + | 291 | WP_264497752.1 | RnfH family protein | - |
| OI450_RS03205 (OI450_03205) | 680092..680592 | + | 501 | WP_264497753.1 | G/U mismatch-specific DNA glycosylase | - |
| OI450_RS03210 (OI450_03210) | 680669..682498 | - | 1830 | WP_264497754.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 672215..699327 | 27112 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 16013.58 Da Isoelectric Point: 10.3857
>T262484 WP_264497749.1 NZ_CP109947:677209-677646 [Pectobacterium cacticida]
VVDFRSSEPSLDEWLKRKASKKQTMGASRTFVVCESGGNQVIGFYALATGSIQRQSVSGALRRNMPDPLPVLVLGRLAVD
ERYHRRGIGAGLLKDAVLRSRLVAEQVGTKALLVHALSEEAKAFYLHWGFTPSEIQPITLLLPLW
VVDFRSSEPSLDEWLKRKASKKQTMGASRTFVVCESGGNQVIGFYALATGSIQRQSVSGALRRNMPDPLPVLVLGRLAVD
ERYHRRGIGAGLLKDAVLRSRLVAEQVGTKALLVHALSEEAKAFYLHWGFTPSEIQPITLLLPLW
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|