Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 2764545..2765196 | Replicon | chromosome |
Accession | NZ_CP109945 | ||
Organism | Lacticaseibacillus paracasei subsp. tolerans strain FX-6-1 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | K6S8L5 |
Locus tag | OH135_RS13385 | Protein ID | WP_003567661.1 |
Coordinates | 2764545..2764928 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | K6RKI5 |
Locus tag | OH135_RS13390 | Protein ID | WP_003567665.1 |
Coordinates | 2764948..2765196 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH135_RS13380 (OH135_13380) | 2763840..2764361 | - | 522 | WP_003567657.1 | QueT transporter family protein | - |
OH135_RS13385 (OH135_13385) | 2764545..2764928 | - | 384 | WP_003567661.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OH135_RS13390 (OH135_13390) | 2764948..2765196 | - | 249 | WP_003567665.1 | antitoxin | Antitoxin |
OH135_RS13395 (OH135_13395) | 2765264..2766400 | - | 1137 | WP_076652501.1 | alanine racemase | - |
OH135_RS13400 (OH135_13400) | 2766387..2766761 | - | 375 | WP_003567669.1 | holo-ACP synthase | - |
OH135_RS13405 (OH135_13405) | 2766931..2768439 | - | 1509 | WP_003567670.1 | DEAD/DEAH box helicase | - |
OH135_RS13410 (OH135_13410) | 2768738..2770126 | - | 1389 | WP_003591978.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13773.03 Da Isoelectric Point: 10.9764
>T262482 WP_003567661.1 NZ_CP109945:c2764928-2764545 [Lacticaseibacillus paracasei subsp. tolerans]
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K6S8L5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2BNY2 |