Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-HTH_37 |
Location | 434837..435465 | Replicon | chromosome |
Accession | NZ_CP109945 | ||
Organism | Lacticaseibacillus paracasei subsp. tolerans strain FX-6-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OH135_RS02075 | Protein ID | WP_076652662.1 |
Coordinates | 435097..435465 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | OH135_RS02070 | Protein ID | WP_003583264.1 |
Coordinates | 434837..435097 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH135_RS02040 (OH135_02040) | 430627..431157 | + | 531 | WP_012490988.1 | DNA-directed RNA polymerase subunit sigma-24 | - |
OH135_RS02045 (OH135_02045) | 431325..431477 | + | 153 | WP_003563363.1 | YvrJ family protein | - |
OH135_RS02050 (OH135_02050) | 431487..432251 | + | 765 | WP_016387929.1 | GH25 family lysozyme | - |
OH135_RS02055 (OH135_02055) | 432462..432965 | + | 504 | WP_003563372.1 | TetR/AcrR family transcriptional regulator | - |
OH135_RS02060 (OH135_02060) | 432970..434031 | + | 1062 | WP_016387927.1 | ABC transporter permease | - |
OH135_RS02065 (OH135_02065) | 434036..434725 | + | 690 | WP_016387926.1 | ABC transporter ATP-binding protein | - |
OH135_RS02070 (OH135_02070) | 434837..435097 | - | 261 | WP_003583264.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OH135_RS02075 (OH135_02075) | 435097..435465 | - | 369 | WP_076652662.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH135_RS02080 (OH135_02080) | 435757..437127 | - | 1371 | WP_016387925.1 | FAD-dependent oxidoreductase | - |
OH135_RS02085 (OH135_02085) | 437491..438309 | - | 819 | WP_019914724.1 | Cof-type HAD-IIB family hydrolase | - |
OH135_RS02090 (OH135_02090) | 438626..438895 | - | 270 | WP_003563382.1 | type II toxin-antitoxin system YafQ family toxin | - |
OH135_RS02095 (OH135_02095) | 439136..440143 | + | 1008 | WP_076652659.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 14969.10 Da Isoelectric Point: 8.0915
>T262481 WP_076652662.1 NZ_CP109945:c435465-435097 [Lacticaseibacillus paracasei subsp. tolerans]
MYKIDFYEDRDGYSEIEDFLDQLRHSHQKNNVSLLNKITKELYMLQNLCPRLREPHAKFLKGYAYPIMELRPMPERIFYA
AWQKDHFVLLHHYTKKTNKTDHREILRAQANLEDWLSRKEEN
MYKIDFYEDRDGYSEIEDFLDQLRHSHQKNNVSLLNKITKELYMLQNLCPRLREPHAKFLKGYAYPIMELRPMPERIFYA
AWQKDHFVLLHHYTKKTNKTDHREILRAQANLEDWLSRKEEN
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|