Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 4285978..4286631 | Replicon | chromosome |
Accession | NZ_CP109943 | ||
Organism | Brevibacillus sp. WF146 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | J2PLP3 |
Locus tag | A6764_RS21295 | Protein ID | WP_005830205.1 |
Coordinates | 4285978..4286328 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A553KJJ6 |
Locus tag | A6764_RS21300 | Protein ID | WP_029101003.1 |
Coordinates | 4286332..4286631 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A6764_RS21270 (A6764_21270) | 4282776..4283564 | - | 789 | WP_065068247.1 | RNA polymerase sigma factor SigB | - |
A6764_RS21275 (A6764_21275) | 4283533..4284024 | - | 492 | WP_065068248.1 | anti-sigma B factor RsbW | - |
A6764_RS21280 (A6764_21280) | 4283997..4284350 | - | 354 | WP_029101006.1 | STAS domain-containing protein | - |
A6764_RS21285 (A6764_21285) | 4284377..4285378 | - | 1002 | WP_029101005.1 | PP2C family protein-serine/threonine phosphatase | - |
A6764_RS21290 (A6764_21290) | 4285375..4285851 | - | 477 | WP_083989938.1 | anti-sigma regulatory factor | - |
A6764_RS21295 (A6764_21295) | 4285978..4286328 | - | 351 | WP_005830205.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
A6764_RS21300 (A6764_21300) | 4286332..4286631 | - | 300 | WP_029101003.1 | CopG family ribbon-helix-helix protein | Antitoxin |
A6764_RS21305 (A6764_21305) | 4286802..4288007 | - | 1206 | WP_044899694.1 | alanine racemase | - |
A6764_RS21310 (A6764_21310) | 4288016..4288456 | - | 441 | WP_035299230.1 | hypothetical protein | - |
A6764_RS21315 (A6764_21315) | 4288658..4289692 | - | 1035 | WP_029100999.1 | DUF4367 domain-containing protein | - |
A6764_RS21320 (A6764_21320) | 4289931..4290317 | - | 387 | WP_044899968.1 | holo-ACP synthase | - |
A6764_RS21325 (A6764_21325) | 4290716..4290880 | - | 165 | WP_065068250.1 | gamma-type small acid-soluble spore protein | - |
A6764_RS21330 (A6764_21330) | 4291107..4291358 | + | 252 | WP_029100996.1 | glutaredoxin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12917.86 Da Isoelectric Point: 4.8435
>T262478 WP_005830205.1 NZ_CP109943:c4286328-4285978 [Brevibacillus sp. WF146]
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVNESLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | J2PLP3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A553KJJ6 |