Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 602746..603232 Replicon chromosome
Accession NZ_CP109941
Organism Streptococcus suis strain ID38828

Toxin (Protein)


Gene name relE Uniprot ID D5AGV2
Locus tag OHM51_RS03030 Protein ID WP_011922754.1
Coordinates 602963..603232 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D5AGV1
Locus tag OHM51_RS03025 Protein ID WP_002938604.1
Coordinates 602746..602973 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHM51_RS03000 (OHM51_03000) 597789..598238 - 450 WP_009909619.1 MarR family transcriptional regulator -
OHM51_RS03005 (OHM51_03005) 598532..599379 + 848 WP_087892711.1 IS630 family transposase -
OHM51_RS03010 (OHM51_03010) 599438..599935 + 498 WP_011922751.1 DUF5590 domain-containing protein -
OHM51_RS03015 (OHM51_03015) 599932..601113 + 1182 WP_011922154.1 pyridoxal phosphate-dependent aminotransferase -
OHM51_RS03020 (OHM51_03020) 601128..602474 + 1347 WP_011922752.1 asparagine--tRNA ligase -
OHM51_RS03025 (OHM51_03025) 602746..602973 + 228 WP_002938604.1 DUF6290 family protein Antitoxin
OHM51_RS03030 (OHM51_03030) 602963..603232 + 270 WP_011922754.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OHM51_RS03035 (OHM51_03035) 603638..604957 + 1320 WP_012775027.1 MATE family efflux transporter -
OHM51_RS03040 (OHM51_03040) 605008..605385 + 378 WP_002937263.1 RidA family protein -
OHM51_RS03045 (OHM51_03045) 605407..606294 + 888 WP_011922160.1 RNase adapter RapZ -
OHM51_RS03050 (OHM51_03050) 606291..607265 + 975 WP_002937257.1 YvcK family protein -
OHM51_RS03055 (OHM51_03055) 607262..608179 + 918 WP_002937252.1 DNA-binding protein WhiA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10437.49 Da        Isoelectric Point: 10.3916

>T262466 WP_011922754.1 NZ_CP109941:602963-603232 [Streptococcus suis]
MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGKALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEI
GHRKEIYKK

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8450.51 Da        Isoelectric Point: 4.1589

>AT262466 WP_002938604.1 NZ_CP109941:602746-602973 [Streptococcus suis]
MGIVSLRLNDAEEEIFRSYAIHTGKSLSELFKTALAEQIEDQLDYEIGIKALKKFQENPVTHSIDDVLAELEDGL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A126UKS2

Antitoxin

Source ID Structure
AlphaFold DB A0A140EXF0

References