Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TscAT/- |
Location | 2853583..2854097 | Replicon | chromosome |
Accession | NZ_CP109933 | ||
Organism | Staphylococcus aureus strain SASWT1215 |
Toxin (Protein)
Gene name | TscT | Uniprot ID | A0A0H3K0C1 |
Locus tag | NT398_RS14280 | Protein ID | WP_001078344.1 |
Coordinates | 2853771..2854097 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | TscA | Uniprot ID | - |
Locus tag | NT398_RS14275 | Protein ID | WP_223200634.1 |
Coordinates | 2853583..2853768 (+) | Length | 62 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NT398_RS14240 (2848805) | 2848805..2849089 | + | 285 | WP_000917289.1 | co-chaperone GroES | - |
NT398_RS14245 (2849165) | 2849165..2850781 | + | 1617 | WP_000240642.1 | chaperonin GroEL | - |
NT398_RS14250 (2850850) | 2850850..2852022 | - | 1173 | WP_000179343.1 | tyrosine-type recombinase/integrase | - |
NT398_RS14255 (2852036) | 2852036..2852710 | - | 675 | WP_000620857.1 | helix-turn-helix transcriptional regulator | - |
NT398_RS14260 (2852883) | 2852883..2853101 | + | 219 | WP_000153640.1 | helix-turn-helix transcriptional regulator | - |
NT398_RS14265 (2853106) | 2853106..2853423 | + | 318 | WP_000481967.1 | helix-turn-helix domain-containing protein | - |
NT398_RS14270 (2853420) | 2853420..2853566 | + | 147 | WP_000784885.1 | hypothetical protein | - |
NT398_RS14275 (2853583) | 2853583..2853768 | + | 186 | WP_223200634.1 | pathogenicity island protein | Antitoxin |
NT398_RS14280 (2853771) | 2853771..2854097 | + | 327 | WP_001078344.1 | DUF1474 family protein | Toxin |
NT398_RS14285 (2854162) | 2854162..2855031 | + | 870 | WP_001002689.1 | primase alpha helix C-terminal domain-containing protein | - |
NT398_RS14290 (2855045) | 2855045..2856754 | + | 1710 | WP_000447473.1 | DUF927 domain-containing protein | - |
NT398_RS14295 (2857064) | 2857064..2857444 | + | 381 | WP_000356942.1 | hypothetical protein | - |
NT398_RS14300 (2857441) | 2857441..2858082 | + | 642 | WP_001047698.1 | hypothetical protein | - |
NT398_RS14305 (2858532) | 2858532..2858873 | + | 342 | WP_001190615.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL / tsst-1 / sec / sell / hlb | 2848805..2890893 | 42088 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12968.26 Da Isoelectric Point: 4.3050
>T262451 WP_001078344.1 NZ_CP109933:2853771-2854097 [Staphylococcus aureus]
MNREIKDLFSDLKLLKDSFEDLKDSNGWHFDELYPYEPNHVLNKDELIGEGFSYHERRIHNNQMFDLFHLYIEQFDNIIE
KFYEIEKASSENFGEESDDAKNSIKVAE
MNREIKDLFSDLKLLKDSFEDLKDSNGWHFDELYPYEPNHVLNKDELIGEGFSYHERRIHNNQMFDLFHLYIEQFDNIIE
KFYEIEKASSENFGEESDDAKNSIKVAE
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|