Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2801500..2802029 | Replicon | chromosome |
Accession | NZ_CP109933 | ||
Organism | Staphylococcus aureus strain SASWT1215 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NT398_RS14010 | Protein ID | WP_000621175.1 |
Coordinates | 2801667..2802029 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NT398_RS14005 | Protein ID | WP_000948331.1 |
Coordinates | 2801500..2801670 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NT398_RS13975 (2796537) | 2796537..2797097 | + | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
NT398_RS13980 (2797305) | 2797305..2797784 | + | 480 | WP_001287087.1 | hypothetical protein | - |
NT398_RS13985 (2797777) | 2797777..2799360 | + | 1584 | WP_001294626.1 | PH domain-containing protein | - |
NT398_RS13990 (2799347) | 2799347..2799838 | + | 492 | WP_001205912.1 | PH domain-containing protein | - |
NT398_RS13995 (2799842) | 2799842..2800201 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
NT398_RS14000 (2800267) | 2800267..2801415 | + | 1149 | WP_001281154.1 | alanine racemase | - |
NT398_RS14005 (2801500) | 2801500..2801670 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NT398_RS14010 (2801667) | 2801667..2802029 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NT398_RS14015 (2802379) | 2802379..2803380 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NT398_RS14020 (2803499) | 2803499..2803825 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NT398_RS14025 (2803827) | 2803827..2804306 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
NT398_RS14030 (2804281) | 2804281..2805051 | + | 771 | WP_001041111.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T262450 WP_000621175.1 NZ_CP109933:2801667-2802029 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|