Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 1233514..1234043 | Replicon | chromosome |
| Accession | NZ_CP109933 | ||
| Organism | Staphylococcus aureus strain SASWT1215 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | K7ZRX2 |
| Locus tag | NT398_RS06275 | Protein ID | WP_001103933.1 |
| Coordinates | 1233514..1233831 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | A0A6B0BJC0 |
| Locus tag | NT398_RS06280 | Protein ID | WP_001058487.1 |
| Coordinates | 1233834..1234043 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NT398_RS06245 (1228729) | 1228729..1229070 | - | 342 | WP_001190615.1 | hypothetical protein | - |
| NT398_RS06250 (1229520) | 1229520..1230161 | - | 642 | WP_001019810.1 | hypothetical protein | - |
| NT398_RS06255 (1230158) | 1230158..1230442 | - | 285 | WP_000998179.1 | hypothetical protein | - |
| NT398_RS06260 (1230444) | 1230444..1230806 | - | 363 | WP_001039169.1 | hypothetical protein | - |
| NT398_RS06265 (1231092) | 1231092..1232561 | - | 1470 | WP_001668899.1 | virulence-associated E family protein | - |
| NT398_RS06270 (1232578) | 1232578..1233447 | - | 870 | WP_001002695.1 | primase alpha helix C-terminal domain-containing protein | - |
| NT398_RS06275 (1233514) | 1233514..1233831 | - | 318 | WP_001103933.1 | DUF1474 family protein | Toxin |
| NT398_RS06280 (1233834) | 1233834..1234043 | - | 210 | WP_001058487.1 | hypothetical protein | Antitoxin |
| NT398_RS06285 (1234036) | 1234036..1234182 | - | 147 | WP_000784893.1 | hypothetical protein | - |
| NT398_RS06290 (1234179) | 1234179..1234406 | - | 228 | WP_000164237.1 | helix-turn-helix transcriptional regulator | - |
| NT398_RS06295 (1234442) | 1234442..1234648 | - | 207 | WP_001060953.1 | hypothetical protein | - |
| NT398_RS06300 (1234869) | 1234869..1235453 | + | 585 | WP_000390814.1 | helix-turn-helix transcriptional regulator | - |
| NT398_RS06305 (1235459) | 1235459..1236565 | + | 1107 | WP_000121223.1 | tyrosine-type recombinase/integrase | - |
| NT398_RS06315 (1237128) | 1237128..1237592 | - | 465 | WP_001085183.1 | SsrA-binding protein SmpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12511.13 Da Isoelectric Point: 4.6364
>T262439 WP_001103933.1 NZ_CP109933:c1233831-1233514 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKEKINDVAIKHGWFVEDKFVKNELETKQEHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASSENFGEESDDAKKLKITE
MNWEIKDLMCDIEVIKEKINDVAIKHGWFVEDKFVKNELETKQEHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASSENFGEESDDAKKLKITE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | K7ZRX2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B0BJC0 |