Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 1233514..1234043 Replicon chromosome
Accession NZ_CP109933
Organism Staphylococcus aureus strain SASWT1215

Toxin (Protein)


Gene name TscT Uniprot ID K7ZRX2
Locus tag NT398_RS06275 Protein ID WP_001103933.1
Coordinates 1233514..1233831 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID A0A6B0BJC0
Locus tag NT398_RS06280 Protein ID WP_001058487.1
Coordinates 1233834..1234043 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NT398_RS06245 (1228729) 1228729..1229070 - 342 WP_001190615.1 hypothetical protein -
NT398_RS06250 (1229520) 1229520..1230161 - 642 WP_001019810.1 hypothetical protein -
NT398_RS06255 (1230158) 1230158..1230442 - 285 WP_000998179.1 hypothetical protein -
NT398_RS06260 (1230444) 1230444..1230806 - 363 WP_001039169.1 hypothetical protein -
NT398_RS06265 (1231092) 1231092..1232561 - 1470 WP_001668899.1 virulence-associated E family protein -
NT398_RS06270 (1232578) 1232578..1233447 - 870 WP_001002695.1 primase alpha helix C-terminal domain-containing protein -
NT398_RS06275 (1233514) 1233514..1233831 - 318 WP_001103933.1 DUF1474 family protein Toxin
NT398_RS06280 (1233834) 1233834..1234043 - 210 WP_001058487.1 hypothetical protein Antitoxin
NT398_RS06285 (1234036) 1234036..1234182 - 147 WP_000784893.1 hypothetical protein -
NT398_RS06290 (1234179) 1234179..1234406 - 228 WP_000164237.1 helix-turn-helix transcriptional regulator -
NT398_RS06295 (1234442) 1234442..1234648 - 207 WP_001060953.1 hypothetical protein -
NT398_RS06300 (1234869) 1234869..1235453 + 585 WP_000390814.1 helix-turn-helix transcriptional regulator -
NT398_RS06305 (1235459) 1235459..1236565 + 1107 WP_000121223.1 tyrosine-type recombinase/integrase -
NT398_RS06315 (1237128) 1237128..1237592 - 465 WP_001085183.1 SsrA-binding protein SmpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12511.13 Da        Isoelectric Point: 4.6364

>T262439 WP_001103933.1 NZ_CP109933:c1233831-1233514 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKEKINDVAIKHGWFVEDKFVKNELETKQEHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASSENFGEESDDAKKLKITE

Download         Length: 318 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8228.24 Da        Isoelectric Point: 4.1682

>AT262439 WP_001058487.1 NZ_CP109933:c1234043-1233834 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSIMNNFESYEHTEYVDGIEVVSEISPEKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB K7ZRX2

Antitoxin

Source ID Structure
AlphaFold DB A0A6B0BJC0

References