Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1206981..1207458 Replicon chromosome
Accession NZ_CP109933
Organism Staphylococcus aureus strain SASWT1215

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NT398_RS06115 Protein ID WP_000052076.1
Coordinates 1207270..1207458 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NT398_RS06110 Protein ID WP_001059690.1
Coordinates 1206981..1207241 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NT398_RS06075 (1202374) 1202374..1203090 - 717 WP_000150011.1 type I 3-dehydroquinate dehydratase -
NT398_RS06080 (1203238) 1203238..1203660 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
NT398_RS06085 (1204059) 1204059..1204553 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
NT398_RS06090 (1204708) 1204708..1205325 + 618 WP_000255551.1 LysE/ArgO family amino acid transporter -
NT398_RS06095 (1205398) 1205398..1205979 - 582 WP_001140693.1 histidine phosphatase family protein -
NT398_RS06100 (1206204) 1206204..1206440 + 237 WP_000349581.1 hypothetical protein -
NT398_RS06105 (1206437) 1206437..1206640 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NT398_RS06110 (1206981) 1206981..1207241 + 261 WP_001059690.1 hypothetical protein Antitoxin
NT398_RS06115 (1207270) 1207270..1207458 + 189 WP_000052076.1 hypothetical protein Toxin
NT398_RS06120 (1207646) 1207646..1208215 + 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NT398_RS06125 (1208303) 1208303..1208587 + 285 WP_001004399.1 hypothetical protein -
NT398_RS06130 (1208649) 1208649..1208867 + 219 WP_000005886.1 hypothetical protein -
NT398_RS06135 (1209359) 1209359..1209559 - 201 WP_001059082.1 cold-shock protein -
NT398_RS06140 (1209916) 1209916..1210602 - 687 WP_000141557.1 thermonuclease family protein -
NT398_RS06145 (1210943) 1210943..1211464 - 522 WP_000824482.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T262438 WP_000052076.1 NZ_CP109933:1207270-1207458 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT262438 WP_001059690.1 NZ_CP109933:1206981-1207241 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References