Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1184576..1185376 Replicon chromosome
Accession NZ_CP109933
Organism Staphylococcus aureus strain SASWT1215

Toxin (Protein)


Gene name - Uniprot ID A0A0C6E139
Locus tag NT398_RS05975 Protein ID WP_031767738.1
Coordinates 1184912..1185376 (+) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag NT398_RS05970 Protein ID WP_001260487.1
Coordinates 1184576..1184899 (+) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NT398_RS05905 (1179832) 1179832..1180095 - 264 WP_001205732.1 hypothetical protein -
NT398_RS05910 (1180104) 1180104..1180364 - 261 WP_000291510.1 DUF1108 family protein -
NT398_RS05915 (1180369) 1180369..1180671 - 303 WP_000165371.1 DUF2482 family protein -
NT398_RS05920 (1180766) 1180766..1180927 - 162 WP_000066020.1 DUF1270 domain-containing protein -
NT398_RS05925 (1180920) 1180920..1181141 - 222 WP_000594788.1 hypothetical protein -
NT398_RS05930 (1181212) 1181212..1181877 + 666 WP_001807461.1 hypothetical protein -
NT398_RS05935 (1181898) 1181898..1181966 - 69 Protein_1142 hypothetical protein -
NT398_RS05940 (1181963) 1181963..1182724 - 762 WP_217658518.1 phage antirepressor KilAC domain-containing protein -
NT398_RS05945 (1182726) 1182726..1182911 - 186 WP_000933363.1 helix-turn-helix transcriptional regulator -
NT398_RS05950 (1183351) 1183351..1183560 + 210 WP_000642492.1 hypothetical protein -
NT398_RS05955 (1183550) 1183550..1183693 - 144 WP_000939498.1 hypothetical protein -
NT398_RS05960 (1183708) 1183708..1184151 - 444 WP_023487065.1 hypothetical protein -
NT398_RS05965 (1184164) 1184164..1184412 - 249 WP_000272859.1 helix-turn-helix transcriptional regulator -
NT398_RS05970 (1184576) 1184576..1184899 + 324 WP_001260487.1 helix-turn-helix transcriptional regulator Antitoxin
NT398_RS05975 (1184912) 1184912..1185376 + 465 WP_031767738.1 toxin Toxin
NT398_RS05980 (1185408) 1185408..1186112 + 705 WP_000440838.1 type II toxin-antitoxin system PemK/MazF family toxin -
NT398_RS05985 (1186310) 1186310..1187359 + 1050 WP_217659178.1 tyrosine-type recombinase/integrase -
NT398_RS05990 (1187427) 1187427..1188824 - 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -
NT398_RS05995 (1188975) 1188975..1189439 - 465 WP_001010508.1 SUF system NifU family Fe-S cluster assembly protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1142668..1188824 46156


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18142.45 Da        Isoelectric Point: 4.6815

>T262437 WP_031767738.1 NZ_CP109933:1184912-1185376 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSNFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT262437 WP_001260487.1 NZ_CP109933:1184576-1184899 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E139

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References