Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5736219..5736827 | Replicon | chromosome |
Accession | NZ_CP109932 | ||
Organism | Pseudomonas aeruginosa strain PALA43 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | PALA43_RS26630 | Protein ID | WP_003114156.1 |
Coordinates | 5736219..5736566 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PALA43_RS26635 | Protein ID | WP_003114155.1 |
Coordinates | 5736576..5736827 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA43_RS26600 (PALA43_05290) | 5731578..5731850 | + | 273 | WP_073651557.1 | cysteine-rich CWC family protein | - |
PALA43_RS26605 (PALA43_05291) | 5731850..5732542 | + | 693 | WP_003114159.1 | 16S rRNA pseudouridine(516) synthase | - |
PALA43_RS26610 (PALA43_05292) | 5732678..5733721 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
PALA43_RS26615 (PALA43_05293) | 5733801..5734538 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PALA43_RS26620 (PALA43_05294) | 5734990..5735892 | + | 903 | WP_269972389.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PALA43_RS26630 (PALA43_05296) | 5736219..5736566 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA43_RS26635 | 5736576..5736827 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA43_RS26640 (PALA43_05297) | 5737041..5738024 | - | 984 | WP_043154346.1 | tyrosine-type recombinase/integrase | - |
PALA43_RS26645 (PALA43_05298) | 5738024..5739316 | - | 1293 | WP_269972390.1 | hypothetical protein | - |
PALA43_RS26650 (PALA43_05300) | 5739546..5740820 | - | 1275 | WP_023093544.1 | zonular occludens toxin family protein | - |
PALA43_RS26655 (PALA43_05301) | 5740824..5741180 | - | 357 | WP_152372558.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 5736219..5757482 | 21263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T262431 WP_003114156.1 NZ_CP109932:c5736566-5736219 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |