Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 1702656..1703293 | Replicon | chromosome |
| Accession | NZ_CP109932 | ||
| Organism | Pseudomonas aeruginosa strain PALA43 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PALA43_RS07880 | Protein ID | WP_019725766.1 |
| Coordinates | 1702656..1702838 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PALA43_RS07885 | Protein ID | WP_019725767.1 |
| Coordinates | 1702871..1703293 (+) | Length | 141 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA43_RS07860 | 1699639..1699782 | + | 144 | WP_153274318.1 | hypothetical protein | - |
| PALA43_RS07865 (PALA43_01566) | 1700108..1700443 | - | 336 | WP_269972481.1 | nuclease-related domain-containing protein | - |
| PALA43_RS07870 (PALA43_01567) | 1700536..1701657 | - | 1122 | WP_080911355.1 | Fic family protein | - |
| PALA43_RS07875 | 1701916..1702053 | - | 138 | WP_003113217.1 | hypothetical protein | - |
| PALA43_RS07880 (PALA43_01568) | 1702656..1702838 | + | 183 | WP_019725766.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PALA43_RS07885 (PALA43_01569) | 1702871..1703293 | + | 423 | WP_019725767.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PALA43_RS07890 (PALA43_01571) | 1703539..1704510 | - | 972 | WP_025982283.1 | hypothetical protein | - |
| PALA43_RS07895 (PALA43_01572) | 1704495..1705187 | - | 693 | WP_019725770.1 | hypothetical protein | - |
| PALA43_RS07900 (PALA43_01573) | 1705184..1705726 | - | 543 | WP_025982284.1 | hypothetical protein | - |
| PALA43_RS07905 (PALA43_01574) | 1705723..1706646 | - | 924 | WP_019725772.1 | hypothetical protein | - |
| PALA43_RS07910 (PALA43_01575) | 1706643..1707119 | - | 477 | WP_019725773.1 | phage tail assembly chaperone | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1700536..1753874 | 53338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6970.07 Da Isoelectric Point: 10.2954
>T262427 WP_019725766.1 NZ_CP109932:1702656-1702838 [Pseudomonas aeruginosa]
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 14970.22 Da Isoelectric Point: 4.9047
>AT262427 WP_019725767.1 NZ_CP109932:1702871-1703293 [Pseudomonas aeruginosa]
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|