Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 1224393..1224898 Replicon chromosome
Accession NZ_CP109932
Organism Pseudomonas aeruginosa strain PALA43

Toxin (Protein)


Gene name parE Uniprot ID A0A069QL22
Locus tag PALA43_RS05625 Protein ID WP_003121619.1
Coordinates 1224393..1224674 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A1C7BDS9
Locus tag PALA43_RS05630 Protein ID WP_003083775.1
Coordinates 1224671..1224898 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA43_RS05600 (PALA43_01110) 1219644..1220993 + 1350 WP_003142411.1 C4-dicarboxylate transporter DctA -
PALA43_RS05605 (PALA43_01111) 1221042..1221728 + 687 WP_003083762.1 FadR/GntR family transcriptional regulator -
PALA43_RS05610 (PALA43_01112) 1221829..1222563 + 735 WP_003117208.1 GntR family transcriptional regulator -
PALA43_RS05615 (PALA43_01113) 1222743..1223153 + 411 WP_003101225.1 aegerolysin family protein -
PALA43_RS05620 (PALA43_01114) 1223185..1224093 - 909 WP_003083769.1 LysR family transcriptional regulator -
PALA43_RS05625 (PALA43_01115) 1224393..1224674 - 282 WP_003121619.1 type II toxin-antitoxin system toxin ParE Toxin
PALA43_RS05630 (PALA43_01116) 1224671..1224898 - 228 WP_003083775.1 CopG family ribbon-helix-helix protein Antitoxin
PALA43_RS05635 (PALA43_01117) 1225074..1225694 - 621 WP_003101226.1 hypothetical protein -
PALA43_RS05640 (PALA43_01118) 1225795..1226295 + 501 WP_003112629.1 LEA type 2 family protein -
PALA43_RS05645 (PALA43_01119) 1226368..1226709 + 342 WP_003101229.1 zinc ribbon domain-containing protein YjdM -
PALA43_RS05650 (PALA43_01120) 1226791..1228218 - 1428 WP_003083784.1 GABA permease -
PALA43_RS05655 (PALA43_01121) 1228387..1229880 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10492.22 Da        Isoelectric Point: 10.0435

>T262426 WP_003121619.1 NZ_CP109932:c1224674-1224393 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8556.58 Da        Isoelectric Point: 5.5740

>AT262426 WP_003083775.1 NZ_CP109932:c1224898-1224671 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHTEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A069QL22

Antitoxin

Source ID Structure
AlphaFold DB A0A1C7BDS9

References