Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2421677..2422317 | Replicon | chromosome |
Accession | NZ_CP109931 | ||
Organism | Pseudomonas aeruginosa strain PALA42 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PALA42_RS11365 | Protein ID | WP_033993319.1 |
Coordinates | 2421907..2422317 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PALA42_RS11360 | Protein ID | WP_031634724.1 |
Coordinates | 2421677..2421907 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA42_RS11350 (PALA42_02242) | 2418679..2419431 | - | 753 | WP_121372664.1 | hypothetical protein | - |
PALA42_RS11355 (PALA42_02243) | 2419440..2421359 | - | 1920 | WP_121372663.1 | type I DNA topoisomerase | - |
PALA42_RS11360 | 2421677..2421907 | + | 231 | WP_031634724.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PALA42_RS11365 (PALA42_02244) | 2421907..2422317 | + | 411 | WP_033993319.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PALA42_RS11370 (PALA42_02245) | 2422333..2422530 | + | 198 | WP_003123325.1 | hypothetical protein | - |
PALA42_RS11375 (PALA42_02246) | 2422544..2422762 | + | 219 | WP_121372662.1 | hypothetical protein | - |
PALA42_RS11380 | 2422828..2423025 | - | 198 | WP_071536305.1 | CrpP family ICE-associated protein | - |
PALA42_RS11385 (PALA42_02247) | 2423525..2424013 | - | 489 | WP_121372661.1 | single-stranded DNA-binding protein | - |
PALA42_RS11390 (PALA42_02248) | 2424027..2424557 | - | 531 | WP_121372660.1 | DUF3158 family protein | - |
PALA42_RS11395 (PALA42_02249) | 2424563..2425291 | - | 729 | WP_009315862.1 | TIGR03761 family integrating conjugative element protein | - |
PALA42_RS11400 (PALA42_02250) | 2425448..2425618 | - | 171 | WP_231786506.1 | hypothetical protein | - |
PALA42_RS11405 (PALA42_02251) | 2425958..2427283 | - | 1326 | WP_121372659.1 | STY4528 family pathogenicity island replication protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15422.76 Da Isoelectric Point: 7.3233
>T262421 WP_033993319.1 NZ_CP109931:2421907-2422317 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVAPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVAPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|