Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4370650..4371485 | Replicon | chromosome |
| Accession | NZ_CP109929 | ||
| Organism | Escherichia coli O6:K2:H1 strain C 691-04A | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | N8A71_RS20960 | Protein ID | WP_000854759.1 |
| Coordinates | 4370650..4371027 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | N8A71_RS20965 | Protein ID | WP_001295723.1 |
| Coordinates | 4371117..4371485 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A71_RS20935 (4366761) | 4366761..4368383 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| N8A71_RS20940 (4369174) | 4369174..4369350 | - | 177 | Protein_4112 | helix-turn-helix domain-containing protein | - |
| N8A71_RS20945 (4369717) | 4369717..4369866 | - | 150 | Protein_4113 | hypothetical protein | - |
| N8A71_RS20950 (4369972) | 4369972..4370148 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| N8A71_RS20955 (4370165) | 4370165..4370653 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| N8A71_RS20960 (4370650) | 4370650..4371027 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| N8A71_RS20965 (4371117) | 4371117..4371485 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N8A71_RS20970 (4371648) | 4371648..4371869 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| N8A71_RS20975 (4371932) | 4371932..4372408 | - | 477 | WP_240771942.1 | RadC family protein | - |
| N8A71_RS20980 (4372424) | 4372424..4372897 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| N8A71_RS20985 (4373239) | 4373239..4374057 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| N8A71_RS20990 (4374175) | 4374175..4374370 | - | 196 | Protein_4122 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4360362..4386021 | 25659 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T262412 WP_000854759.1 NZ_CP109929:c4371027-4370650 [Escherichia coli O6:K2:H1]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT262412 WP_001295723.1 NZ_CP109929:c4371485-4371117 [Escherichia coli O6:K2:H1]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |