Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4289035..4289611 | Replicon | chromosome |
| Accession | NZ_CP109929 | ||
| Organism | Escherichia coli O6:K2:H1 strain C 691-04A | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A061KXE4 |
| Locus tag | N8A71_RS20560 | Protein ID | WP_001295743.1 |
| Coordinates | 4289324..4289611 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A066STF6 |
| Locus tag | N8A71_RS20555 | Protein ID | WP_000063148.1 |
| Coordinates | 4289035..4289337 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A71_RS20540 (4285631) | 4285631..4287781 | + | 2151 | WP_001295524.1 | pyruvate/proton symporter BtsT | - |
| N8A71_RS20545 (4287831) | 4287831..4288034 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
| N8A71_RS20550 (4288045) | 4288045..4289001 | + | 957 | WP_001295745.1 | GTPase | - |
| N8A71_RS20555 (4289035) | 4289035..4289337 | - | 303 | WP_000063148.1 | BrnA antitoxin family protein | Antitoxin |
| N8A71_RS20560 (4289324) | 4289324..4289611 | - | 288 | WP_001295743.1 | BrnT family toxin | Toxin |
| N8A71_RS20565 (4289808) | 4289808..4290974 | + | 1167 | WP_000800831.1 | restriction endonuclease | - |
| N8A71_RS20570 (4291038) | 4291038..4292657 | + | 1620 | WP_001029745.1 | class I SAM-dependent DNA methyltransferase | - |
| N8A71_RS20575 (4292647) | 4292647..4293951 | + | 1305 | WP_000535012.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11156.62 Da Isoelectric Point: 7.4697
>T262411 WP_001295743.1 NZ_CP109929:c4289611-4289324 [Escherichia coli O6:K2:H1]
MPMEFEWDANKAKSNRVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERSRYEHG
MPMEFEWDANKAKSNRVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061KXE4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066STF6 |