Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1001467..1002121 | Replicon | chromosome |
Accession | NZ_CP109929 | ||
Organism | Escherichia coli O6:K2:H1 strain C 691-04A |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | N8A71_RS04955 | Protein ID | WP_000244781.1 |
Coordinates | 1001714..1002121 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N8A71_RS04950 | Protein ID | WP_000354046.1 |
Coordinates | 1001467..1001733 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8A71_RS04930 (997555) | 997555..998988 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
N8A71_RS04935 (999033) | 999033..999344 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
N8A71_RS04940 (999508) | 999508..1000167 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
N8A71_RS04945 (1000244) | 1000244..1001224 | - | 981 | WP_000886079.1 | tRNA-modifying protein YgfZ | - |
N8A71_RS04950 (1001467) | 1001467..1001733 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N8A71_RS04955 (1001714) | 1001714..1002121 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
N8A71_RS04960 (1002161) | 1002161..1002682 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
N8A71_RS04965 (1002794) | 1002794..1003690 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N8A71_RS04970 (1003715) | 1003715..1004425 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N8A71_RS04975 (1004431) | 1004431..1006164 | + | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T262396 WP_000244781.1 NZ_CP109929:1001714-1002121 [Escherichia coli O6:K2:H1]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|