Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4228149..4228725 | Replicon | chromosome |
| Accession | NZ_CP109924 | ||
| Organism | Escherichia coli O125ac:K+:H10 strain C 236-04A | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | D3GXZ2 |
| Locus tag | N8A72_RS20600 | Protein ID | WP_001297643.1 |
| Coordinates | 4228438..4228725 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A080I7H7 |
| Locus tag | N8A72_RS20595 | Protein ID | WP_000063160.1 |
| Coordinates | 4228149..4228451 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A72_RS20580 (4224745) | 4224745..4226895 | + | 2151 | WP_001295524.1 | pyruvate/proton symporter BtsT | - |
| N8A72_RS20585 (4226945) | 4226945..4227148 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
| N8A72_RS20590 (4227159) | 4227159..4228115 | + | 957 | WP_001297640.1 | GTPase | - |
| N8A72_RS20595 (4228149) | 4228149..4228451 | - | 303 | WP_000063160.1 | BrnA antitoxin family protein | Antitoxin |
| N8A72_RS20600 (4228438) | 4228438..4228725 | - | 288 | WP_001297643.1 | BrnT family toxin | Toxin |
| N8A72_RS20605 (4228924) | 4228924..4229620 | - | 697 | Protein_4050 | IS1 family transposase | - |
| N8A72_RS20610 (4229935) | 4229935..4231167 | + | 1233 | WP_001137031.1 | multidrug efflux MFS transporter MdtM | - |
| N8A72_RS20615 (4231208) | 4231208..4232488 | + | 1281 | WP_001037390.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4228924..4229133 | 209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11295.77 Da Isoelectric Point: 6.8821
>T262390 WP_001297643.1 NZ_CP109924:c4228725-4228438 [Escherichia coli O125ac:K+:H10]
MPMEFEWDENKAKSNRVKHGIRFEDAVLLFDDPQHLSQQERIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
MPMEFEWDENKAKSNRVKHGIRFEDAVLLFDDPQHLSQQERIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829GEV9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A080I7H7 |