Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3840759..3841438 Replicon chromosome
Accession NZ_CP109924
Organism Escherichia coli O125ac:K+:H10 strain C 236-04A

Toxin (Protein)


Gene name ykfI Uniprot ID S1FHS4
Locus tag N8A72_RS18705 Protein ID WP_000854680.1
Coordinates 3841097..3841438 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID S1EWR7
Locus tag N8A72_RS18700 Protein ID WP_000070396.1
Coordinates 3840759..3841076 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8A72_RS18655 (3836197) 3836197..3837018 + 822 WP_000197389.1 DUF932 domain-containing protein -
N8A72_RS18660 (3837235) 3837235..3837936 + 702 WP_023326104.1 WYL domain-containing protein -
N8A72_RS18665 (3837977) 3837977..3838213 + 237 WP_057107659.1 protein YpjK -
N8A72_RS18670 (3838213) 3838213..3838656 + 444 WP_001547764.1 lipoprotein YafY -
N8A72_RS18675 (3838679) 3838679..3839146 + 468 WP_001547765.1 protein YkfB -
N8A72_RS18680 (3839223) 3839223..3839462 + 240 WP_000194654.1 DUF905 family protein -
N8A72_RS18685 (3839560) 3839560..3840018 + 459 WP_000211838.1 antirestriction protein -
N8A72_RS18690 (3840034) 3840034..3840510 + 477 WP_000811693.1 RadC family protein -
N8A72_RS18695 (3840519) 3840519..3840740 + 222 WP_000691994.1 DUF987 domain-containing protein -
N8A72_RS18700 (3840759) 3840759..3841076 + 318 WP_000070396.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
N8A72_RS18705 (3841097) 3841097..3841438 + 342 WP_000854680.1 type IV toxin-antitoxin system toxin YkfI Toxin
N8A72_RS18710 (3842037) 3842037..3842396 + 360 WP_001371750.1 hypothetical protein -
N8A72_RS18715 (3842389) 3842389..3842877 - 489 WP_001371756.1 plasmid pRiA4b ORF-3 family protein -
N8A72_RS18720 (3842975) 3842975..3843409 - 435 WP_032283080.1 hypothetical protein -
N8A72_RS18725 (3843412) 3843412..3843867 - 456 WP_001371753.1 DUF4065 domain-containing protein -
N8A72_RS18730 (3844189) 3844189..3844374 - 186 WP_001371755.1 hypothetical protein -
N8A72_RS18735 (3844672) 3844672..3844953 - 282 WP_001529725.1 PerC family transcriptional regulator -
N8A72_RS18740 (3845225) 3845225..3845668 + 444 WP_001344215.1 hypothetical protein -
N8A72_RS18745 (3845748) 3845748..3845969 + 222 WP_000678609.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12892.95 Da        Isoelectric Point: 9.6543

>T262387 WP_000854680.1 NZ_CP109924:3841097-3841438 [Escherichia coli O125ac:K+:H10]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11982.62 Da        Isoelectric Point: 7.0270

>AT262387 WP_000070396.1 NZ_CP109924:3840759-3841076 [Escherichia coli O125ac:K+:H10]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFIRQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1FHS4

Antitoxin

Source ID Structure
AlphaFold DB S1EWR7

References